Recombinant Solanum lycopersicum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKTNILVVGPVPG KKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its function in plants?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of plants. It functions as an electron carrier in the thylakoid membrane of chloroplasts, facilitating electron transfer between photosystem II and photosystem I during photosynthesis. In its mature form as cytochrome f, the protein contains a heme group that enables it to participate in redox reactions essential for photosynthetic energy conversion. Research indicates that mutations affecting petA gene expression can significantly impact photosynthetic efficiency and plant growth, as demonstrated in studies with Arabidopsis thaliana mutants . The protein plays a crucial role in adapting to fluctuating light environments, allowing plants to optimize photosynthetic performance under varying conditions .

How should recombinant Apocytochrome f be stored and handled in laboratory settings?

Proper storage and handling of recombinant Apocytochrome f is critical for maintaining protein integrity and experimental reproducibility. The recommended storage conditions are:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Buffer compositionTris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose, pH 8.0
Freeze-thaw cyclesMinimize; repeated freeze-thawing is not recommended
ReconstitutionReconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% (final concentration) for aliquots stored at -20°C/-80°C

Prior to opening, it is recommended that vials be briefly centrifuged to bring contents to the bottom. For optimal stability, aliquoting the protein after initial thawing is necessary to avoid repeated freeze-thaw cycles that can compromise protein structure and function .

What expression systems are commonly used for producing recombinant Apocytochrome f?

Escherichia coli is the predominant expression system used for producing recombinant Apocytochrome f from Solanum lycopersicum. This bacterial expression system offers several advantages including high protein yields, cost-effectiveness, and rapid growth. The recombinant protein can be expressed with fusion tags (such as His-tag) to facilitate purification . When expressing Apocytochrome f in E. coli, researchers typically use the mature protein sequence (amino acids 36-320) rather than the full precursor that contains the chloroplast transit peptide. This approach enhances expression efficiency while providing a functional protein suitable for in vitro studies .

What are the optimal conditions for reconstitution and functional assays of recombinant Apocytochrome f?

Reconstitution and functional analysis of recombinant Apocytochrome f require careful optimization to ensure proper protein folding and activity. The recommended protocol includes:

  • Initial reconstitution: Centrifuge the vial briefly before opening, then reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Buffer optimization: For functional studies, a Tris-based buffer system at pH 8.0 is generally recommended, though modifications may be necessary depending on the specific assay .

  • Stabilization with glycerol: Addition of 5-50% glycerol (final concentration) helps maintain protein stability during storage and handling. The optimal glycerol concentration may vary depending on the downstream application and should be determined empirically .

  • Redox activity assessment: Electron transfer capacity can be measured spectrophotometrically by monitoring changes in absorbance at wavelengths characteristic of the heme group (typically around 550-560 nm) during reduction-oxidation reactions.

  • Reconstitution in liposomes: For functional studies requiring a membrane environment, the protein can be incorporated into liposomes composed of plant thylakoid lipids (monogalactosyldiacylglycerol, digalactosyldiacylglycerol, and phosphatidylglycerol) at lipid-to-protein ratios between 50:1 and 100:1.

These conditions should be further optimized based on specific experimental requirements and objectives.

How can post-translational modifications of Apocytochrome f be identified and characterized?

Post-translational modifications (PTMs) of Apocytochrome f play significant roles in regulating its function and interactions. Several methodological approaches are effective for their identification and characterization:

  • Mass spectrometry-based proteomics: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) is the gold standard for comprehensive PTM identification. This approach has successfully identified lysine succinylation sites on Apocytochrome f .

  • Enrichment strategies: Prior to MS analysis, modified peptides should be enriched using:

    • Antibodies specific to the modification (e.g., anti-succinyl-lysine antibodies)

    • Chemical labeling approaches

    • Affinity chromatography specific to the modification of interest

  • Site-directed mutagenesis: Confirmation of functionally important modification sites can be performed by mutating the modified residues (e.g., lysine to arginine to prevent succinylation) and assessing functional consequences.

  • Bioinformatic analysis: Prediction tools can help identify potential modification sites based on sequence motifs and structural features, guiding experimental verification.

Table of common PTMs identified on Apocytochrome f:

Modification TypeDetection MethodFunctional Implication
Lysine succinylationLC-MS/MS with anti-succinyl-lysine enrichmentRegulation of protein-protein interactions and enzyme activity
PhosphorylationLC-MS/MS with TiO₂ or IMAC enrichmentPotential regulation of protein stability and electron transport efficiency
Oxidative modificationsRedox proteomics approachesResponse to oxidative stress and potential regulatory mechanism

What approaches can be used to study Apocytochrome f interactions with other components of the photosynthetic electron transport chain?

Understanding protein-protein interactions involving Apocytochrome f is crucial for elucidating its role in photosynthetic electron transport. Several complementary techniques can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against Apocytochrome f (such as the Anti-Cytochrome f antibody) to pull down the protein complex, followed by identification of interaction partners through immunoblotting or mass spectrometry.

  • Yeast two-hybrid (Y2H) assays: Though challenging for membrane proteins, modified split-ubiquitin Y2H systems can be utilized to screen for potential interaction partners.

  • Bimolecular Fluorescence Complementation (BiFC): This in vivo approach can visualize protein interactions in plant cells by fusing complementary fragments of fluorescent proteins to potential interaction partners.

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics between purified recombinant Apocytochrome f and other purified components of the electron transport chain.

  • Cryo-electron microscopy: Structural analysis of protein complexes containing Apocytochrome f to determine interaction interfaces at near-atomic resolution.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis to identify proteins in close proximity to Apocytochrome f within native complexes.

For all these methods, appropriate controls must be included to distinguish specific from non-specific interactions, and results should be validated using multiple complementary techniques.

How does lysine succinylation affect the function of Apocytochrome f in photosynthetic electron transport?

Lysine succinylation is an emerging post-translational modification that can significantly impact protein function. Recent proteomic studies have identified lysine succinylation sites in Apocytochrome f , suggesting potential regulatory roles in photosynthetic electron transport. The effects of this modification may include:

Methodologically, researchers can investigate these effects through:

  • Site-directed mutagenesis of succinylated lysine residues

  • In vitro succinylation assays followed by functional measurements

  • Comparison of electron transport rates in wild-type versus mutant proteins

  • Structural studies comparing modified and unmodified proteins

What are the challenges in producing functional recombinant Apocytochrome f and how can they be addressed?

Production of functional recombinant Apocytochrome f presents several challenges that researchers should consider:

ChallengeSolution Strategies
Proper folding and heme incorporation- Co-expression with heme lyases or chaperones
- Optimization of growth conditions (temperature, induction timing)
- Use of specialized E. coli strains designed for membrane protein expression
Solubility issues- Expression as fusion proteins with solubility-enhancing tags
- Addition of mild detergents during purification
- Use of amphipols or nanodiscs for membrane protein stabilization
Protein degradation- Addition of protease inhibitors during purification
- Optimization of expression time to prevent inclusion body formation
- Use of protease-deficient host strains
Low expression yields- Codon optimization for E. coli expression
- Testing different promoter systems
- Evaluation of alternative expression hosts (yeast, insect cells)
Maintaining native conformation- Careful selection of detergents and buffer conditions
- Reconstitution into liposomes or nanodiscs
- Rapid purification at low temperatures

A particularly effective approach involves expressing the mature protein (amino acids 36-320) with an N-terminal His-tag in E. coli, followed by affinity purification under conditions that maintain the integrity of the protein's structure . Functional validation using spectroscopic methods to assess heme incorporation and electron transfer capability is essential before using the recombinant protein in experiments.

How can researchers design experiments to compare wild-type and mutant forms of Apocytochrome f?

Comparative analysis of wild-type and mutant Apocytochrome f requires careful experimental design:

  • Mutation selection: Choose mutations based on:

    • Conserved functional domains identified through sequence alignment

    • Known post-translational modification sites

    • Residues implicated in protein-protein interactions or electron transfer

  • Expression and purification controls:

    • Express wild-type and mutant proteins under identical conditions

    • Purify using the same protocol to minimize variation

    • Verify protein integrity and purity via SDS-PAGE and Western blot analysis

  • Functional assays:

    • Spectroscopic analysis to assess heme incorporation

    • Electron transfer kinetics using stopped-flow spectroscopy

    • Protein-protein interaction studies using SPR or pull-down assays

    • In vitro reconstitution of partial or complete electron transport chains

  • Data analysis considerations:

    • Perform statistical analysis to determine significance of observed differences

    • Account for batch-to-batch variation through biological replicates

    • Include appropriate controls for each assay

    • Consider both steady-state and pre-steady-state kinetics

  • In vivo validation:

    • Complement plant mutants lacking functional Apocytochrome f with mutant variants

    • Assess photosynthetic parameters in complemented plants

    • Measure growth and physiological responses under various light conditions

This comprehensive approach enables researchers to establish structure-function relationships and elucidate the impact of specific residues on Apocytochrome f function.

What are the best practices for using Apocytochrome f antibodies in research applications?

Anti-Cytochrome f antibodies are valuable tools for research , but require careful consideration for optimal results:

  • Antibody selection criteria:

    • Confirm cross-reactivity with your species of interest (antibodies show varying specificity across plant species)

    • Choose between polyclonal antibodies (higher sensitivity, broader epitope recognition) and monoclonal antibodies (higher specificity, consistent lot-to-lot)

    • Validate antibody specificity via Western blot before use in experiments

  • Western blot optimization:

    • Sample preparation: Extract proteins from thylakoid membranes using appropriate detergents

    • Recommended dilutions: Start with 1:1000 to 1:5000 for primary antibody

    • Blocking conditions: 5% non-fat dry milk or BSA in TBS-T for 1 hour at room temperature

    • Appropriate controls: Include positive control (purified protein), negative control, and molecular weight marker

  • Immunolocalization protocols:

    • Fixation: 4% paraformaldehyde for 20-30 minutes

    • Permeabilization: 0.1-0.5% Triton X-100 for 10-15 minutes

    • Primary antibody incubation: Overnight at 4°C

    • Detection: Fluorescently-labeled secondary antibodies for confocal microscopy

  • Troubleshooting common issues:

    • High background: Increase blocking time, optimize antibody dilution, add 0.05% Tween-20 to wash buffer

    • Weak signal: Increase protein loading, reduce washing stringency, optimize antibody concentration

    • Non-specific bands: Increase blocking concentration, use more specific antibody, optimize SDS-PAGE conditions

  • Storage and handling:

    • Store lyophilized antibodies according to manufacturer recommendations

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots to maintain antibody integrity

Careful optimization of these parameters ensures reliable and reproducible results when using Anti-Cytochrome f antibodies in research applications.

What are common troubleshooting strategies for experiments involving recombinant Apocytochrome f?

When working with recombinant Apocytochrome f, researchers may encounter several challenges that require specific troubleshooting approaches:

IssuePossible CausesTroubleshooting Strategies
Low protein yield- Suboptimal expression conditions
- Protein toxicity
- Poor solubility
- Optimize growth temperature (try 16-30°C range)
- Adjust IPTG concentration (0.1-1.0 mM)
- Test different E. coli strains
- Use auto-induction media
Poor protein stability- Improper storage conditions
- Proteolytic degradation
- Oxidation of sensitive residues
- Add appropriate protease inhibitors
- Maintain reducing conditions with DTT or β-mercaptoethanol
- Store with 50% glycerol at -80°C
- Avoid repeated freeze-thaw cycles
Inactive protein- Improper folding
- Incomplete heme incorporation
- Denaturation during purification
- Optimize reconstitution protocol
- Verify heme incorporation spectroscopically
- Use milder purification conditions
- Consider refolding protocols
Aggregation- Hydrophobic interactions
- Improper buffer conditions
- Concentration too high
- Add mild detergents (0.03-0.1% DDM)
- Optimize buffer ionic strength and pH
- Keep protein concentration <1 mg/mL
- Include stabilizing agents (glycerol, trehalose)
Inconsistent results- Batch-to-batch variation
- Environmental factors
- Inconsistent handling
- Standardize purification protocol
- Prepare larger batches and aliquot
- Include internal controls
- Document all experimental conditions

Implementing these troubleshooting strategies systematically can help resolve common issues and improve experimental reproducibility when working with recombinant Apocytochrome f.

How can researchers effectively compare Apocytochrome f proteins across different plant species?

Comparative analysis of Apocytochrome f from different plant species can provide valuable insights into evolutionary conservation and functional adaptations. A systematic approach includes:

  • Sequence and structural comparison:

    • Perform multiple sequence alignment using MUSCLE or CLUSTAL

    • Calculate sequence identity and similarity percentages

    • Identify conserved domains and variable regions

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Use homology modeling to predict structural differences

  • Expression and purification strategy:

    • Use identical expression systems and tags for all orthologs

    • Optimize purification protocols for each species if necessary

    • Verify protein integrity through SDS-PAGE and mass spectrometry

    • Quantify protein concentration using consistent methods

  • Functional characterization:

    • Compare electron transfer kinetics under identical conditions

    • Assess stability and activity across temperature and pH ranges

    • Evaluate redox potentials using cyclic voltammetry

    • Measure binding affinities for interaction partners

  • Cross-reactivity analysis:

    • Test antibody cross-reactivity across species

    • Develop species-specific antibodies for differential detection

    • Use epitope mapping to identify conserved antigenic regions

  • In vivo functional complementation:

    • Express orthologs in model systems lacking endogenous protein

    • Assess ability to restore photosynthetic electron transport

    • Measure growth and physiological parameters under various conditions

This comprehensive approach enables robust comparison of Apocytochrome f proteins across species, providing insights into both conserved functions and species-specific adaptations.

What techniques are most effective for studying the integration of Apocytochrome f into the cytochrome b6f complex?

Understanding how Apocytochrome f integrates into the cytochrome b6f complex requires specialized techniques that address both structural and functional aspects:

  • Membrane protein reconstitution approaches:

    • Detergent-mediated reconstitution into proteoliposomes

    • Nanodisc technology for creating defined membrane environments

    • Cell-free expression systems with supplied lipids or nanodiscs

  • Structural analysis techniques:

    • Cryo-electron microscopy for near-atomic resolution structures

    • Single-particle analysis to resolve heterogeneous populations

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Functional assays:

    • Measurement of coordinated electron transfer through the complex

    • Monitoring proton translocation coupled to electron transfer

    • Assessing quinol oxidation and plastocyanin reduction in reconstituted systems

  • Analysis of assembly intermediates:

    • Pulse-chase experiments to track protein incorporation into complexes

    • Blue native PAGE to separate assembly intermediates

    • Immunoprecipitation of partially assembled complexes

    • Time-resolved proteomics to identify assembly factors

  • Mutagenesis approaches:

    • Targeted mutations at predicted interaction interfaces

    • Truncation analysis to identify minimal regions required for complex formation

    • Domain swapping between species to identify specificity determinants

These techniques provide complementary information about the structural features, kinetic parameters, and regulatory mechanisms governing Apocytochrome f integration into functional cytochrome b6f complexes.

What are emerging areas of research involving Apocytochrome f and photosynthetic electron transport?

Several cutting-edge research directions are emerging in the study of Apocytochrome f and its role in photosynthetic electron transport:

  • Synthetic biology approaches:

    • Design of minimal synthetic electron transport chains

    • Engineering of Apocytochrome f variants with altered redox properties

    • Creation of hybrid systems combining components from different photosynthetic organisms

  • Environmental adaptation mechanisms:

    • Investigation of how Apocytochrome f function adapts to extreme environments

    • Study of regulatory mechanisms in fluctuating light conditions

    • Analysis of stress-induced post-translational modifications

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, transcriptomics, and metabolomics

    • Flux balance analysis of electron transport under varying conditions

    • Computational modeling of electron transfer dynamics and control mechanisms

  • Biotechnological applications:

    • Development of biosensors based on electron transfer proteins

    • Enhancement of photosynthetic efficiency through targeted modifications

    • Bio-inspired design of artificial photosynthetic systems

  • Advanced structural biology:

    • Time-resolved structural studies capturing intermediate states

    • Integration of structural data across scales (atomic to cellular)

    • In situ structural analysis within native thylakoid membranes

These emerging research areas promise to deepen our understanding of photosynthetic electron transport while potentially leading to applications in renewable energy, agriculture, and biotechnology.

How might CRISPR/Cas9 technology be applied to study Apocytochrome f function in vivo?

CRISPR/Cas9 genome editing technology offers powerful approaches for investigating Apocytochrome f function in living plants:

  • Precise gene editing strategies:

    • Introduction of point mutations to study specific functional residues

    • Creation of tagged versions for in vivo tracking and isolation

    • Generation of conditional knockouts using inducible systems

    • Engineering of plants expressing orthologous petA genes from other species

  • Experimental design considerations:

    • Design of specific guide RNAs targeting the chloroplast petA gene

    • Selection of appropriate promoters for expressing Cas9 in chloroplasts

    • Development of efficient chloroplast transformation protocols

    • Screening and validation strategies for edited plants

  • Phenotypic analysis approaches:

    • Measurement of photosynthetic parameters (electron transport rates, photosystem efficiency)

    • Growth analysis under various light and stress conditions

    • Metabolomic profiling to assess downstream effects

    • Chloroplast structure and ultrastructure examination

  • Technical challenges and solutions:

    • Chloroplast genome editing is more challenging than nuclear genome editing

    • Multiple copies of the chloroplast genome require strategies for homoplasmy

    • Tissue-specific or developmentally regulated editing may require specialized systems

    • Off-target effects must be carefully monitored and minimized

  • Integration with other techniques:

    • Combination with high-resolution imaging for localization studies

    • Integration with proteomics to identify interaction partners

    • Coupling with metabolic flux analysis to assess functional impact

CRISPR/Cas9 technology thus provides unprecedented opportunities to manipulate and study Apocytochrome f function within its native cellular context, potentially leading to new insights into photosynthetic electron transport regulation and optimization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.