Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant AtpI is produced by cloning the atpI gene from tomato (Solanum lycopersicum) into bacterial systems (e.g., E. coli) for large-scale purification. Key specifications include:

ParameterDetails
Gene NameatpI
UniProt IDQ2VEI8 (tomato) / Q4FGF8 (homologs in other species)
Protein Length247 amino acids (full-length)
TagN-terminal His tag for purification
Expression HostEscherichia coli
Purity>90% (verified via SDS-PAGE)

This protein is commercially available from suppliers like Creative BioMart and MyBioSource for research applications .

Domain Architecture

AtpI is a key component of the proton channel in the F₀ sector of cpATPase. It facilitates proton translocation across the thylakoid membrane, enabling ATP synthesis .

Key Features

  • Proton Translocation: Critical for maintaining the proton gradient required for ATP generation .

  • Interaction Networks: Binds with other cpATPase subunits (e.g., AtpB, AtpE) and assembly factors (e.g., BFA1, BFA3) .

  • Redox Regulation: Modulates reactive oxygen species (ROS) homeostasis under stress .

Stress Response and Disease Resistance

  • Pathogen Resistance: Overexpression of atpA (a related cpATPase subunit) in transgenic tobacco reduced Botrytis cinerea infection by enhancing ATP content (3.7–4.4-fold) and balancing ROS .

  • Salt Tolerance: Transgenic plants overexpressing atpA exhibited improved salinity tolerance through enhanced ATPase activity and H⁺/Ca²⁺ efflux .

  • Low-Temperature Adaptation: Overexpression of the ATP synthase β subunit in tomato increased cold tolerance by elevating antioxidant enzyme activity (SOD, POD, CAT) and photosynthetic efficiency .

Chloroplast Biogenesis

  • AtpI interacts with assembly factors like AtpF and AtpG, which stabilize mRNA transcripts (e.g., atpE) during cpATPase assembly .

  • Silencing atpE or atpF in cotton increased ROS levels, linking cpATPase subunits to redox homeostasis .

Agricultural Engineering

  • Stress-Resilient Crops: Overexpression of cpATPase subunits enhances resistance to biotic (fungal pathogens) and abiotic (salinity, cold) stresses .

  • Photosynthetic Optimization: Targeting AtpI could improve ATP synthesis efficiency, benefiting crop yields under suboptimal conditions .

Comparative Analysis

ParameterS. lycopersicum AtpIHomolog in Acorus americanus
Amino Acid Sequence247 residues 247 residues
Expression SystemE. coli E. coli
Key FunctionProton channel Proton channel

Future Directions

  • Mechanistic Studies: Elucidate AtpI’s role in ROS signaling during pathogen invasion .

  • Crop Engineering: Develop tomato lines with edited atpI to test drought and heat tolerance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKRGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a is a crucial component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: sly:3950464

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does the expression of ATP synthase subunit a change under different stress conditions in tomato?

    The expression of ATP synthase components, including subunit a, demonstrates significant plasticity in response to various stresses:

    Under low-temperature stress:

    • Expression of ATP synthase subunits is generally downregulated in wild-type tomato plants

    • In transgenic plants overexpressing the ATP synthase β subunit gene, the photosynthetic apparatus maintains higher functionality during cold stress

    Under pathogen infection:

    • Expression of the ATP synthase CF1 α subunit (AtpA) is upregulated in response to fungal pathogens like Botrytis cinerea and beneficial fungi like Clonostachys rosea

    • This upregulation is part of the plant's defense response mechanism

    During fruit ripening:

    • The expression of specific ATP synthase subunits changes, particularly with the incorporation of an atypical γ-subunit in chromoplasts that replaces the standard chloroplast γ-subunit

    These expression changes reflect the adaptive responses of the tomato energy metabolism system to various environmental challenges.

  • What techniques are most effective for isolating and purifying recombinant ATP synthase subunit a from tomato?

    The isolation and purification of recombinant ATP synthase subunit a from tomato involves several specialized techniques:

    Expression System Selection:

    • E. coli expression systems are commonly used for producing recombinant ATP synthase subunits with N-terminal His tags for easier purification

    • Agrobacterium-mediated transformation has been successfully used for generating transgenic tomato plants with modified ATP synthase expression

    Organelle Isolation Protocol:

    1. Dark adaptation of plants (27 hours) to reduce starch accumulation

    2. High-yielding chloroplast isolation using optimized buffers for tomato leaves

    3. Chloroplast lysis and stromal protein collection by centrifugation

    4. Protein precipitation typically using acetone

    Protein Purification Steps:

    • Affinity chromatography using His-tag binding for recombinant proteins

    • Storage in appropriate buffer systems (typically Tris-based buffer with 50% glycerol)

    • Lyophilization into powder form for long-term storage

    Quality Assessment:

    • SDS-PAGE for purity determination (>90% purity standard)

    • Confirmation of activity through functional assays

    For researchers working with tomato chloroplast proteins, a high-yielding protocol has been developed that allows the isolation of highly pure chloroplast and stromal proteins from tomato leaves, yielding comprehensive identification of over 1,278 stromal proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.