Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 13, chloroplastic (CAB13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CAB13; LHBC1; Chlorophyll a-b binding protein 13, chloroplastic; LHCII type III CAB-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-265
Protein Length
Full Length of Mature Protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
CAB13
Target Protein Sequence
SNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRW AMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGF QVVLMGLVEGFRINGLPGVGEGNDLYPGGQYFDPLGLADDPTTFAELKVKEIKNGRLAMF SMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGA
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Gene References Into Functions
  1. The type III Light Harvesting Chlorophyll a/b Binding protein 13 (CAB-13) gene is a key determinant of continuous light tolerance. PMID: 25093373
Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CAB-13 in tomato plants and how was it initially characterized?

CAB-13 (Chlorophyll a-b binding protein 13) is a type III Light harvesting chlorophyll a/b binding protein encoded by the LHCB type III CAB-13 gene located on chromosome seven of tomato (Solanum lycopersicum). It plays a crucial role in the photosynthetic machinery and has been particularly identified for its involvement in continuous light (CL) tolerance in tomatoes.

The characterization of CAB-13 emerged from studies mapping CL-tolerance in wild tomato species. Researchers identified a positive correlation between CAB-13 expression and CL-tolerance through genetic mapping and expression analysis. In CL-sensitive tomatoes, continuous light conditions down-regulated CAB-13 expression, while in CL-tolerant lines (such as the "CLT" introgression line), CAB-13 expression remained high under continuous light exposure. When CAB-13 expression was silenced in the CL-tolerant line using virus-induced gene silencing (VIGS), plants lost their tolerance to continuous light, firmly establishing the functional connection between CAB-13 and CL-tolerance .

How does CAB-13 relate to light signaling pathways in tomato?

CAB-13 appears to be intricately connected to phytochrome-mediated light signaling pathways. Research has revealed that phytochrome A (PHYA) likely regulates CAB-13 expression, similar to how it regulates other CAB proteins in tomatoes. This relationship is supported by studies showing that PHYA overexpression confers complete CL-tolerance in tomatoes regardless of light spectral distribution.

The regulatory connection can be compared to the better-studied tomato CAB-1 protein (located on chromosome two). CAB-1 expression is regulated by multiple light wavelengths (ultraviolet, blue, red, and far-red light), suggesting involvement of several photoreceptors, with at least PHYA and PHYB1 confirmed to regulate its expression. This indicates that PHYA signaling might act upstream of CAB-13, similar to CAB-1 .

Experimental evidence demonstrates that:

  • Different light spectral distributions influence CL-induced injury severity

  • Higher percentages of blue light increase CL-induced injury

  • Addition of far-red light reduces injury in tomato

  • PHYA overexpression confers complete CL-tolerance regardless of light spectral distribution

What expression patterns does CAB-13 exhibit in different tomato varieties?

CAB-13 expression patterns differ significantly between continuous light (CL)-sensitive and CL-tolerant tomato varieties. Expression analysis reveals:

Tomato VarietyLighting ConditionCAB-13 Expression LevelPhenotype
CL-sensitive cultivars (e.g., Moneymaker)Continuous lightDown-regulatedCL-induced injury
CL-tolerant introgression line (CLT)Continuous lightMaintained high expressionCL-tolerance
CL-tolerant line with CAB-13 silencedContinuous lightArtificially reducedLoss of CL-tolerance

RNAseq data further reveals that CAB-13-mediated CL-tolerance is associated with higher expression of all tomato CAB proteins. While expression of most photosynthesis genes in CL-sensitive tomato plants is repressed by continuous light, CL-tolerant plants show higher expression of these genes when exposed to continuous light .

Interestingly, HY5 (a positive regulator of light-responsive genes) is up-regulated by continuous light in CL-sensitive tomatoes, but shows no expression difference between CL-tolerant and CL-sensitive plants when both are exposed to continuous light. This suggests complex regulatory mechanisms beyond simple HY5-mediated pathways .

What experimental designs are most effective for studying CAB-13 function in tomatoes?

Effective experimental designs for studying CAB-13 function should incorporate multiple approaches to establish causality and elucidate mechanisms. Based on current research methodologies, the following design elements are recommended:

A. Genetic Manipulation Studies:

  • VIGS (Virus-Induced Gene Silencing): This approach has proven effective for silencing CAB-13 in CL-tolerant lines to confirm its role in CL-tolerance. The experimental design should include appropriate vector controls and quantification of silencing efficiency .

  • CRISPR-Cas13d System: For targeted RNA knockdown without affecting DNA, the two-plasmid delivery approach is recommended. For optimal CAB-13 knockdown efficiency:

    • Design guide RNAs with the anti-start codon positioned centrally in the spacer region

    • Use a guide RNA with a 30-nt spacer targeting the start codon

    • Implement fluorescent reporter systems (e.g., split GFP) to monitor transfection efficiency

B. Expression Analysis Studies:

  • Implement a factorial design with variables including:

    • Light condition (normal photoperiod vs. continuous light)

    • Light spectral distribution (varying far-red and blue light percentages)

    • Tomato genotype (wild-type, introgression lines, mutants)

C. Protein Interaction Studies:

  • Use co-immunoprecipitation followed by mass spectrometry to identify CAB-13 interacting partners

  • Implement bimolecular fluorescence complementation (BiFC) to visualize protein interactions in vivo

D. Data Collection and Analysis Considerations:

  • Ensure clear distinction between independent variables (manipulated by researcher) and dependent variables (measured responses)2

  • Place experimental design statements at the beginning of methods section rather than conflating them with statistical analysis sections

  • When reporting results, clearly distinguish between study design (how data were obtained) and statistical design (how data were analyzed)

For physiological studies, simultaneous gas exchange and chlorophyll fluorescence measurements can be performed using instruments like LiCor 6400 with the 6400–40 leaf chamber fluorometer head, maintaining ambient lighting and temperature around the whole plant while protocols are performed on individual leaves .

How can CRISPR-Cas technologies be optimized for studying CAB-13 expression and function?

CRISPR-Cas technologies offer powerful tools for studying CAB-13 expression and function. Based on recent advances, the following optimized approaches are recommended:

A. CRISPR-Cas13d for Translational Repression:
The CRISPR-Cas13d system has been successfully adapted for targeted gene expression knockdown in various model organisms and can be optimized for studying CAB-13 in tomatoes .

Implementation Strategy:

  • Two-Plasmid Delivery System:

    • First plasmid: pCAG-Cas13d-T2A-GFP(1–10) containing catalytically inactive Cas13d (dCas13d)

    • Second plasmid: gRNA construct with fluorescent protein reporter followed by three tandem gRNAs

  • Guide RNA Design for Optimal CAB-13 Repression:

    • Use 30-nt spacers with the anti-start codon positioned centrally (positions 9-17 within the spacer)

    • Include hammerhead (HH) and hepatitis delta virus (HDV) ribozyme self-cleavage sites flanking the gRNA sequence

    • Incorporate reporter systems (either two-color or single-color) to monitor transformation efficiency

  • Verification System:

    • Co-express with luciferase reporters to quantify knockdown efficiency

    • One luciferase acts as the direct target while another serves as an internal control

B. CRISPR-Cas9 for Genomic Modification:
For permanent genetic modifications of the CAB-13 gene:

  • Design multiple guide RNAs targeting:

    • The coding sequence of CAB-13

    • Promoter regions to study transcriptional regulation

    • Intron-exon junctions to disrupt splicing

  • Construct Design Considerations:

    • Include ribozymes for precise processing of gRNAs

    • Use plant-optimized Cas9 with appropriate nuclear localization signals

    • Incorporate selectable markers compatible with tomato transformation

Validation Protocol:

  • Sequence verification of mutations

  • RT-qPCR to confirm altered expression

  • Western blotting to verify protein levels

  • Phenotypic assessment under continuous light conditions

What are the methodological challenges in recombinant expression and purification of CAB-13 protein?

Recombinant expression and purification of CAB-13 present several methodological challenges that must be addressed for successful structural and functional studies:

A. Expression System Selection:
Chlorophyll-binding proteins require specific conditions for proper folding and function. The following systems have distinct advantages and limitations:

Expression SystemAdvantagesLimitationsRecommendations
E. coliHigh yield, rapid growthLacks chloroplast-like environmentUse specialized strains (e.g., Rosetta-gami) with chaperones
Insect cellsBetter folding of complex proteinsHigher cost, longer production timeBaculovirus expression with thioredoxin fusion tags
Plant-based systemsNative-like post-translational modificationsLower yield, longer production timePreferred for functional studies of CAB-13

B. Technical Challenges:

  • Chlorophyll Integration:

    • CAB-13 requires chlorophyll molecules for proper folding and function

    • Solution: Co-expression with chlorophyll synthesis genes or reconstitution with purified chlorophyll

  • Membrane Association:

    • As a chloroplastic protein, CAB-13 has hydrophobic domains that complicate soluble expression

    • Solution: Use of specialized detergents (n-Dodecyl β-D-maltoside or digitonin) during purification

  • Protein Stability:

    • Light-sensitive nature requires dark or green-light conditions during purification

    • Solution: Addition of antioxidants and working under appropriate light conditions

C. Purification Strategy:

  • Initial Purification:

    • Affinity chromatography using His-tag or Strep-tag II

    • Detergent screening for optimal solubilization

  • Intermediate Purification:

    • Ion exchange chromatography

    • Size exclusion chromatography for separating monomeric from oligomeric forms

  • Final Quality Assessment:

    • Circular dichroism to verify secondary structure

    • Absorption spectroscopy to confirm chlorophyll binding

    • Mass spectrometry for identity confirmation

D. Functional Validation:

  • Reconstitution into liposomes or nanodiscs for functional studies

  • Fluorescence-based assays to measure chlorophyll binding and energy transfer

How does phytochrome signaling interact with CAB-13 expression and what methodologies best capture this relationship?

The interaction between phytochrome signaling and CAB-13 expression represents a complex regulatory network that requires specialized methodologies to elucidate:

A. Current Understanding of the Interaction:
Research has established that phytochrome A (PHYA) plays a dominant role in regulating CAB-13 expression and conferring continuous light (CL) tolerance in tomatoes. Evidence indicates that:

  • PHYA overexpression confers complete CL-tolerance regardless of light spectral distribution

  • PHYB1 and PHYB2 have less dominant roles that depend on light spectral distribution

  • The light spectral distribution influences the severity of CL-induced injury, with far-red light reducing injury and blue light increasing it

B. Recommended Methodologies for Studying This Interaction:

  • Genetic Approaches:

    • Create crosses between phytochrome mutants (phyA, phyB1, phyB2) and CAB-13 overexpression/silenced lines

    • Generate double and triple mutants to assess epistatic relationships

    • Use phytochrome overexpressing lines (PHYAOE, PHYB1OE, PHYB2OE) to study gain-of-function effects

  • Molecular Biology Techniques:

    • Chromatin immunoprecipitation (ChIP) to identify direct binding of phytochrome-interacting factors to the CAB-13 promoter

    • Promoter-reporter fusions (e.g., CAB-13 promoter driving luciferase) to monitor transcriptional regulation in real-time

    • Electrophoretic mobility shift assays (EMSA) to detect protein-DNA interactions involving the CAB-13 promoter

  • Light Treatment Experiments:

    • Design factorial experiments with variables including:

      • Light quality (different ratios of red/far-red/blue light)

      • Light intensity

      • Photoperiod (including continuous light)

    • Measure CAB-13 expression under each condition using RT-qPCR or RNA-Seq

  • Phosphorylation Analysis:

    • Assess phytochrome-dependent phosphorylation of transcription factors that might regulate CAB-13

    • Use phosphoproteomic approaches to identify signaling cascades

C. Data Analysis Framework:
For complex light-response experiments, implement mixed-effects models that account for:

  • Fixed effects: light quality, intensity, duration, genotype

  • Random effects: experimental batch, plant position

  • Covariates: plant developmental stage, time of day

Additionally, network analysis of transcriptomic data can help identify co-regulated genes and regulatory hubs connecting phytochrome signaling to CAB-13 expression.

How can introgression lines be utilized to study CAB-13 variants and their phenotypic effects?

Introgression lines provide powerful tools for studying CAB-13 variants and their phenotypic effects by incorporating segments of wild tomato genomes into cultivated tomato backgrounds. Here's a methodological framework for utilizing these resources:

A. Selection and Development of Appropriate Introgression Lines:

  • Identify Sources of CAB-13 Variation:

    • Wild tomato species with continuous light (CL) tolerance, such as those used to map the CAB-13 gene on chromosome seven

    • Species with diverse photoperiodic responses or stress tolerance traits

  • Introgression Line Development Strategies:

    • Conventional backcrossing with marker-assisted selection

    • Creation of chromosome segment substitution lines (CSSLs) focusing on chromosome seven

    • Development of near-isogenic lines (NILs) with smaller introgressions around the CAB-13 locus

  • Double-Introgression Approaches:

    • Create lines containing homeologous segments on opposite chromosome arms to increase recombination rates

    • Research shows recombination is higher in double than in single segment lines

B. Phenotypic Characterization Methodologies:

  • Light Response Assessments:

    • Continuous light tolerance evaluation using standardized injury scoring

    • Chlorophyll fluorescence measurements to assess photosynthetic efficiency

    • Growth measurements under various light regimes

  • Molecular Characterization:

    • Expression profiling of CAB-13 variants using RT-qPCR

    • Protein abundance and modification analysis using proteomics

    • Analysis of metabolic changes associated with different CAB-13 variants

C. Recombination Enhancement Strategies:
When studying introgressions from distant relatives like Solanum lycopersicoides, address the reduced recombination rates (as low as 0-10% of expected frequencies) by:

  • Manipulating Introgression Size:

    • Use longer introgressions, which correlate with higher recombination rates (up to 40-50% of normal)

    • Engineer double-introgression lines with segments on opposite chromosome arms

  • Utilizing Intermediate Species Crosses:

    • Cross S. lycopersicoides introgression lines to phylogenetically intermediate species (e.g., L. pennellii)

    • Target regions of overlap between different wild species segments, which show highest recombination rates

D. Statistical Analysis Framework:

  • Implement QTL mapping to identify additional loci that interact with CAB-13

  • Use advanced backcross QTL (AB-QTL) mapping strategies to identify favorable alleles

  • Develop introgression line (IL) libraries for map-based cloning approaches

This methodological framework enables the exploration of natural variation in CAB-13 and its correlation with important agricultural traits while addressing the challenges of working with interspecific crosses.

What is the relationship between CAB-13 expression, reactive oxygen species (ROS), and chloroplast function?

The relationship between CAB-13 expression, reactive oxygen species (ROS), and chloroplast function represents a critical aspect of plant stress physiology and photosynthetic efficiency. Understanding this relationship requires integrated methodological approaches:

A. Current Understanding of the Relationship:
Disruption of photosynthetic light-harvesting proteins like CAB-13 can impact ROS production and management in chloroplasts. In continuous light (CL)-sensitive tomatoes, downregulation of CAB-13 correlates with increased ROS production, suggesting CAB-13 plays a role in minimizing oxidative stress under continuous illumination .

B. Methodological Approaches for Investigation:

  • ROS Detection and Quantification:

    • Histochemical Methods:

      • 3,3'-Diaminobenzidine (DAB) staining for H₂O₂

      • Nitroblue tetrazolium (NBT) for superoxide detection

    • Fluorescent Probes:

      • 2',7'-Dichlorodihydrofluorescein diacetate (H₂DCF-DA) for general ROS detection

      • MitoSOX Red for mitochondrial superoxide detection

    • Spectrophotometric Assays:

      • Ferrous oxidation-xylenol orange (FOX) assay for H₂O₂ quantification

  • Antioxidant Enzyme Activity Assays:
    Measure key enzymes involved in ROS scavenging using the following protocols:

    EnzymeAssay MethodExpected Response in CAB-13 Deficient Plants
    Ascorbate peroxidase (APX)Decrease in absorbance at 290 nm as ascorbate is oxidizedIncreased activity
    Catalase (CAT)Decrease in absorbance at 240 nm as H₂O₂ is degradedIncreased activity
    Superoxide dismutase (SOD)Inhibition of NBT reductionIncreased activity
    Glutathione reductase (GR)Decrease in absorbance at 340 nm as NADPH is oxidizedIncreased activity
  • Chloroplast Function Assessment:

    • Chlorophyll fluorescence parameters (Fv/Fm, ΦPSII, NPQ)

    • P700 absorbance changes for PSI activity

    • Electron transport rate measurements

    • Chloroplast membrane integrity assays

  • Molecular Analyses:

    • Transcriptomic profiling to identify co-regulated genes involved in ROS management

    • Western blotting to assess protein oxidation (carbonylation)

    • qRT-PCR to measure expression of ROS-responsive genes

C. Experimental Design Considerations:

  • Compare CAB-13 wildtype, overexpression, and knockdown lines

  • Expose plants to varying light intensities, qualities, and durations

  • Include treatments with ROS scavengers (e.g., ascorbate, glutathione) or generators (e.g., methyl viologen)

D. Physiological Impact Assessment:

  • Monitor growth parameters under different light and oxidative stress conditions

  • Assess photosynthetic efficiency using gas exchange measurements

  • Evaluate stress symptom development (chlorosis, necrosis) in relation to ROS levels

How do environmental factors affect CAB-13 expression and function, and what experimental designs best capture these interactions?

Environmental factors significantly influence CAB-13 expression and function in tomatoes, with important implications for plant photosynthetic efficiency and stress tolerance. Here's a methodological framework for investigating these interactions:

A. Key Environmental Factors Affecting CAB-13:

  • Light Conditions:

    • Photoperiod (especially continuous light)

    • Light quality (spectral distribution, particularly red/far-red ratio and blue light percentage)

    • Light intensity

  • Temperature:

    • Heat and cold stress

    • Temperature fluctuations

  • Carbon Dioxide Levels:

    • Ambient vs. elevated CO₂ concentrations

    • Relationship with carbonic anhydrase activity in chloroplasts

  • Water Availability:

    • Drought stress

    • Rehydration responses

B. Comprehensive Experimental Design Framework:

  • Factorial Experimental Design:
    Implement a multifactorial approach that systematically varies:

    • Light conditions (photoperiod, intensity, spectral quality)

    • Temperature regimes

    • CO₂ concentrations

    • Water availability

    This design allows for analysis of both main effects and interactions between environmental factors .

  • Time-Course Sampling:

    • Short-term responses (hours to days)

    • Long-term acclimation (weeks)

    • Developmental stage-specific effects

  • Controlled Environment Chambers:

    • Use specialized growth chambers that can precisely control multiple environmental parameters simultaneously

    • Implement diurnal cycling of parameters to mimic natural conditions

  • Field Validation Studies:

    • Validate controlled environment findings under natural conditions

    • Use portable measurement devices for in-field assessment

C. Measurement and Analysis Protocols:

  • CAB-13 Expression Analysis:

    • RT-qPCR for targeted gene expression analysis

    • RNA-Seq for genome-wide expression profiling

    • Use time-series sampling to capture expression dynamics

  • Protein Quantification:

    • Western blotting with specific antibodies

    • Proteomic approaches to identify post-translational modifications

  • Physiological Measurements:

    • Simultaneous gas exchange and chlorophyll fluorescence measurements using instruments like LiCor 6400

    • Monitor parameters including:

      • Net CO₂ assimilation rate

      • Stomatal conductance

      • Chlorophyll fluorescence parameters (Fv/Fm, ΦPSII, NPQ)

      • Photosynthetic response curves

  • Statistical Analysis Framework:

    • Implement mixed-effects models to account for repeated measures and nested designs

    • Use multivariate approaches to identify patterns across multiple response variables

    • Implement structural equation modeling to test causal relationships

D. Integration with Other Systems:
For comprehensive understanding, integrate CAB-13 studies with:

  • Carbonic Anhydrase (CA) Function:
    Recent research shows that chloroplast CA is necessary for plant development by providing bicarbonate for biosynthetic reactions .

  • Phytochrome Signaling:
    CAB-13 expression appears to be regulated by phytochrome A (PHYA), which confers complete CL-tolerance in tomatoes .

  • Reactive Oxygen Species (ROS) Management:
    Monitor ROS production and antioxidant enzyme activities to correlate with CAB-13 expression under different environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.