Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D)

Shipped with Ice Packs
In Stock

Description

Introduction to Chlorophyll a-b Binding Proteins in Tomato

Chlorophyll a-b binding proteins (CABs) constitute an essential protein family in photosynthetic organisms, including tomato (Solanum lycopersicum). These proteins function primarily as components of the light-harvesting complexes (LHCs) of photosystems I and II, where they bind chlorophyll molecules and facilitate the capture and transfer of light energy to reaction centers. The tomato genome encodes multiple CAB proteins organized into distinct subfamilies based on their sequence homology and functional roles. CAB proteins are nuclear-encoded but targeted to the chloroplast, representing a critical connection between nuclear gene expression and chloroplast function.

The CAB protein family in tomato includes at least 14 different genes that have been identified and characterized in terms of their expression patterns and functional significance . These genes are differentially expressed, with some producing abundant transcripts while others are expressed at lower levels. The differential expression patterns suggest specialized roles for individual CAB proteins in photosynthesis and chloroplast development, reflecting the complex regulatory networks governing these essential processes in tomato plants.

Expression and Regulation of CAB1D

The expression of CAB1D is subject to complex regulation at multiple levels, from transcription to translation and protein stability. Studies examining the steady-state mRNA levels of cab gene family members in tomato have revealed differential expression patterns among the various genes. While the transcripts of cab 1A, cab 1B, cab 3A, and cab 3B, which encode Type I LHC proteins of photosystem II, accumulate to abundant levels, other cab genes, including those encoding Type II LHC II and LHC I proteins, are expressed at lower levels . These differences in expression levels suggest specialized roles for the different CAB proteins in photosynthesis and related processes.

Transcriptional regulation of cab 1D involves light-responsive elements and specific transcription factors. Analysis of cab gene promoters has identified characteristic GATA repeats with conserved spacing in the 5' upstream sequences of several cab genes, including those in the cab 1AD subfamily . These elements are known to mediate light-dependent transcriptional activation, which is critical for coordinating CAB expression with photosynthetic activity. Additionally, the transcription initiation site for many cab genes, including cab 1D, has been found to center on the triplet TCA, suggesting conserved mechanisms for transcription initiation .

Recent research has identified specific transcription factors involved in regulating CAB genes in tomato. For instance, the BEL1-LIKE HOMEODOMAIN 11 (SlBEL11) transcription factor has been shown to bind to the promoters of CAB genes and regulate their expression . RNA sequencing of SlBEL11-silenced tomato plants revealed upregulation of numerous genes involved in chlorophyll biosynthesis, photosynthesis, and chloroplast development, including those encoding chlorophyll a/b binding proteins. Chromatin immunoprecipitation and electrophoretic mobility shift assays have confirmed the direct binding of SlBEL11 protein to CAB gene promoters, providing evidence for direct transcriptional regulation .

Functional Role of CAB1D in Tomato Plants

CAB1D, as a member of the chlorophyll a/b binding protein family, plays a crucial role in photosynthesis by participating in light harvesting and energy transfer within the photosystems. The functional significance of CAB proteins is underscored by studies examining the effects of altered CAB expression on plant phenotypes. For instance, research has demonstrated that silencing of genes encoding translational regulators that target CAB transcripts results in chloroplast dysfunction and visible phenotypic changes, including yellowing of leaves and reduced plant growth .

The importance of CAB proteins in chloroplast development and function is further highlighted by studies of regulatory networks involving these proteins. The translational efficiency of nuclear-encoded chloroplast proteins, including CABs, is modulated by RNA-binding proteins such as SlRBP1, which interacts with eukaryotic translation initiation factors to promote the translation of photosynthesis-associated transcripts . Silencing of SlRBP1 results in decreased translational efficiency of its target mRNAs, including those encoding key photosynthesis-related, chloroplast-targeted proteins, demonstrating the complex regulatory mechanisms governing CAB protein production and function.

The integration of CAB proteins into functional photosynthetic complexes requires coordination with chlorophyll synthesis and chloroplast development. Transcription factors such as SlBEL11 have been shown to regulate both CAB gene expression and other genes involved in chlorophyll biosynthesis and chloroplast development, ensuring the synchronized production of all components required for photosynthetic function . The coordinated regulation of these processes is essential for efficient photosynthesis and, consequently, for plant growth, development, and productivity.

Production and Applications of Recombinant CAB1D

The production of recombinant CAB1D involves the expression of the cab 1D gene in heterologous systems, enabling the isolation and purification of the protein for various applications. According to available supplier information, recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D is commercially available from providers such as CUSABIO TECHNOLOGY LLC . The production of recombinant CAB proteins typically involves expression in bacterial, yeast, or insect cell systems, followed by purification using affinity chromatography or other protein purification techniques.

Table 1: Commercial Suppliers of Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D)

SupplierCountryContact InformationAdvantage Score
CUSABIO TECHNOLOGY LLCChinaTel: 027-87196173, Email: cusabio@163.com58

Applications of recombinant CAB1D span both research and potential practical uses. In research contexts, purified recombinant CAB proteins serve as valuable tools for studying protein-protein interactions, chlorophyll binding mechanisms, and the assembly of photosynthetic complexes. These studies contribute to our fundamental understanding of photosynthesis and plant physiology, with implications for improving crop productivity and stress resistance.

The potential practical applications of recombinant CAB proteins include their use as biomarkers for monitoring plant stress responses and as targets for genetic engineering to enhance photosynthetic efficiency. Given the correlation between CAB expression levels and photosynthetic performance, manipulating CAB genes, including cab 1D, represents a promising approach for developing crops with improved photosynthetic capacity and, consequently, higher yields. Additionally, understanding the regulation of CAB genes could facilitate the development of tomato varieties with enhanced tolerance to environmental stresses that affect photosynthesis.

Current Research and Future Perspectives

Current research on CAB proteins, including CAB1D, focuses on elucidating their roles within the broader context of chloroplast function and development in tomato plants. Recent studies have investigated the regulatory networks governing CAB gene expression, identifying key transcription factors such as SlBEL11 that directly regulate CAB genes along with other genes involved in chloroplast development and chlorophyll synthesis . These findings provide insights into the coordinated regulation of nuclear-encoded chloroplast proteins and highlight potential targets for manipulating photosynthetic efficiency.

Another active area of research involves the translational regulation of nuclear-encoded chloroplast proteins. Studies have identified RNA-binding proteins such as SlRBP1 that specifically control the translation of target mRNAs encoding key photosynthesis-related, chloroplast-targeted proteins . The discovery of these translational regulatory mechanisms adds another layer to our understanding of how plants coordinate nuclear gene expression with chloroplast function and underscores the complexity of the regulatory networks governing photosynthesis.

Future research directions might include detailed structural studies of CAB1D and other CAB proteins to elucidate the molecular basis of chlorophyll binding and energy transfer within the light-harvesting complexes. Additionally, investigating the responses of different CAB genes, including cab 1D, to various environmental stresses could provide insights into the adaptive mechanisms of tomato plants and inform strategies for developing stress-resistant varieties. The potential applications of CRISPR/Cas9 and other genome editing technologies for precisely modifying CAB genes represent exciting possibilities for enhancing photosynthetic efficiency and crop productivity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice packaging is preferred, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. The default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of your specified tag.
Synonyms
CAB1D; Chlorophyll a-b binding protein 1D; LHCII type I CAB-1D; LHCP; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
CAB1D
Target Protein Sequence
SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and delivering excitation energy to associated photosystems.
Database Links

UniGene: Les.4345

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.