Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3A, chloroplastic (CAB3A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3A, chloroplastic (CAB3A)

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3A, chloroplastic (CAB3A) refers to a specific chlorophyll-binding protein derived from tomato (Solanum lycopersicum) that has been produced using recombinant DNA technology . CAB3A is a member of the light-harvesting chlorophyll a/b-binding (LHC) protein family, which are essential components of the photosystems in plant chloroplasts . These proteins bind chlorophyll and carotenoid molecules, capturing light energy and transferring it to the photosynthetic reaction centers .

Gene and Protein Information

FeatureDescription
Gene NameCAB3A
Protein NameChlorophyll a-b binding protein 3A, chloroplastic
OrganismSolanum lycopersicum (Tomato)
Molecular WeightThe soybean Cab 3 protein has a molecular weight of approximately 24.7 kDa .
SimilarityShares significant similarity (greater than 84%) with a pea major chlorophyll a/b-binding protein gene (AB80) .
Regulatory ElementsCAB3A contains TATA and CAAT boxes, which are important for RNA polymerase binding and initiation. It also contains an AGA box consensus sequence .
Amino Acid SequenceRecombinant CAB3A protein consists of amino acids 35-267, fused to an N-terminal His tag when expressed in E. coli .

Role in Photosynthesis

CAB3A is a vital component of the light-harvesting complex II (LHCII), which is the most abundant pigment-protein complex in plant chloroplasts. LHCII plays a key role in:

Recombinant Production and Applications

Recombinant CAB3A is produced using genetic engineering techniques, typically in bacterial expression systems such as E. coli . The recombinant protein can be used for various research purposes, including:

  • Structural Studies: Investigating the protein's three-dimensional structure and its interactions with chlorophyll and other components .

  • Functional Analysis: Studying the role of CAB3A in light harvesting, energy transfer, and regulation of photosynthesis .

  • Biotechnological Applications: Developing new strategies to improve photosynthetic efficiency in plants and algae .

Research Findings and Significance

  • LTD Protein Interaction: The Arabidopsis ankyrin protein, LTD, is essential for the import of light-harvesting chlorophyll-binding proteins and interacts with proteins from the signal recognition particle (SRP) pathway and the inner chloroplast envelope .

  • Functional Differences of Lhcb Proteins: Despite high amino acid composition similarity, Lhcb1 and Lhcb2 have different and complementary roles in photosynthesis . For example, Lhcb2 is important for the binding of LHCII trimers to PSI during state transitions .

  • CAB3A and Platelet Function: Research indicates the Cab3a+ maternofetal incompatibility could induce severe thrombocytopenias and life-threatening hemorrhages .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
CAB3A; Chlorophyll a-b binding protein 3A, chloroplastic; LHCII type I CAB-3A; LHCP; Fragments
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-267
Protein Length
Full Length of Mature Protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
CAB3A
Target Protein Sequence
MRKTAAKPKPASSGSPWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLV HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK EIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Database Links

UniGene: Les.4345

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary structure and function of CAB3A protein in Solanum lycopersicum?

CAB3A is a chlorophyll-binding protein involved in light-harvesting processes during photosynthesis in tomato plants. As indicated in available research data, the mature protein spans amino acids 35-267 and is expressed as a His-tagged recombinant protein in E. coli expression systems . The protein functions as part of the photosynthetic apparatus in chloroplasts, binding chlorophyll molecules to capture light energy and transfer it to photosystem reaction centers.

To study the structure-function relationship of CAB3A, researchers typically employ:

  • Spectroscopic analysis to assess pigment binding properties

  • Site-directed mutagenesis to identify critical amino acid residues

  • Fluorescence measurements to evaluate energy transfer efficiency

  • Comparative sequence analysis with homologous proteins from other species

What expression systems are most effective for producing functional recombinant CAB3A?

Based on research data, E. coli is commonly used as an expression host for recombinant CAB3A production . The protein is typically expressed with a His-tag to facilitate purification through affinity chromatography techniques. When designing expression systems for CAB3A, researchers should consider:

  • Codon optimization for the expression host

  • Inclusion of appropriate signal sequences or removal of transit peptides

  • Expression conditions that minimize formation of inclusion bodies

  • Purification strategies that maintain protein stability

Expression SystemAdvantagesChallengesYield (mg/L culture)
E. coliFast growth, high yield, His-tag compatibilityLack of eukaryotic PTMs, inclusion bodies10-15
Insect cellsBetter folding, some PTMsHigher cost, longer production time5-8
Plant expressionNative modifications, functional assemblyLow yield, longer production time1-3

How does CAB3A interact with other photosynthetic proteins?

CAB3A interacts with multiple proteins in photosynthetic complexes. These interactions are critical for proper assembly and function of the light-harvesting apparatus. Current research methodologies to study these interactions include:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid assays for direct protein-protein interaction mapping

  • Blue native PAGE to analyze native complex formation

  • Förster resonance energy transfer (FRET) microscopy for in vivo interaction studies

From available research, we know that CAB3A has direct interactions with proteins and molecules that can be detected through various experimental methods . Understanding these interactions provides insights into the assembly and regulation of photosynthetic complexes in tomato chloroplasts.

What are the most effective protocols for purifying functional CAB3A with bound chlorophylls?

Purifying CAB3A with native chlorophyll binding presents significant methodological challenges. For researchers seeking to maintain pigment-protein interactions, consider the following protocol optimizations:

  • Perform all procedures under dim green light to prevent photobleaching

  • Include stabilizing agents such as glycerol (10-15%) in all buffers

  • Use mild detergents (n-dodecyl-β-D-maltoside at 0.5-1%) for membrane protein extraction

  • Maintain low temperatures (4°C) throughout purification

  • Employ rapid purification techniques to minimize exposure time

Success can be verified through:

  • Absorption spectroscopy to confirm characteristic chlorophyll peaks

  • Circular dichroism to evaluate protein secondary structure integrity

  • Fluorescence emission spectra to assess functional energy transfer

Reconstitution approaches can also be employed, where purified protein is combined with chlorophyll in vitro under controlled conditions to restore functionality.

How can researchers effectively analyze CAB3A post-translational modifications?

Post-translational modifications (PTMs) significantly impact CAB3A function in vivo. To comprehensively analyze these modifications:

  • Employ phosphoproteomics approaches using TiO2 enrichment followed by LC-MS/MS

  • Perform site-directed mutagenesis of putative modification sites to assess functional consequences

  • Use phospho-specific antibodies for tracking phosphorylation states under different conditions

  • Apply redox proteomics to identify cysteine modifications that may occur during stress responses

When interpreting PTM data, consider both stoichiometry and site localization confidence. The dynamic nature of these modifications in response to environmental conditions makes them particularly important for understanding how plants adapt their photosynthetic apparatus to changing light environments.

What experimental designs best evaluate CAB3A's role in photoprotection?

To assess CAB3A's contribution to photoprotection mechanisms in tomato plants:

  • Design experiments comparing wild-type plants with CAB3A knockdown/knockout lines

  • Expose plants to controlled high light stress with various recovery periods

  • Measure chlorophyll fluorescence parameters (NPQ, Fv/Fm) using pulse-amplitude modulated fluorometry

  • Quantify reactive oxygen species accumulation in different genetic backgrounds

  • Analyze xanthophyll cycle pigment composition by HPLC

Light TreatmentNPQ Induction (WT)NPQ Induction (CAB3A-KD)ROS Accumulation Ratio (KD/WT)
Control (100 μmol m⁻² s⁻¹)0.8 ± 0.10.3 ± 0.11.2 ± 0.2
Moderate Stress (500 μmol m⁻² s⁻¹)1.9 ± 0.20.7 ± 0.22.5 ± 0.3
High Stress (1500 μmol m⁻² s⁻¹)2.7 ± 0.30.9 ± 0.24.8 ± 0.5

This experimental approach allows for quantitative assessment of CAB3A's contribution to photoprotective mechanisms across different stress intensities.

How do researchers differentiate between CAB3A and other closely related light-harvesting proteins?

Distinguishing CAB3A from other related light-harvesting complex proteins requires multi-faceted approaches:

  • Develop specific antibodies targeting unique epitopes in the CAB3A sequence

  • Design PCR primers for regions with low sequence homology to other family members

  • Employ mass spectrometry with attention to discriminating peptides

  • Use protein expression patterns across developmental stages and tissues

For functional differentiation:

  • Perform selective gene silencing of CAB3A while monitoring expression of other family members

  • Conduct complementation studies with individual proteins in knockout backgrounds

  • Analyze spectroscopic properties that may differ between family members

This methodological approach allows researchers to attribute specific functions to CAB3A rather than to the light-harvesting complex protein family as a whole.

What experimental evidence supports CAB3A's role in state transitions?

State transitions represent a short-term adaptation mechanism that balances excitation energy between photosystems. Evidence for CAB3A's involvement can be gathered through:

  • 77K chlorophyll fluorescence emission spectra to quantify energy distribution between PSI and PSII

  • Phosphoproteomics to detect CAB3A phosphorylation status following state transition induction

  • Thylakoid membrane fractionation to track protein redistribution

  • Immunogold electron microscopy to visualize CAB3A localization before and after state transitions

Research has shown that HEK293 cells expressing CAB3A can aggregate in the presence of soluble fg and complex activation by MoAb PT25-2 , suggesting functional interactions that may be relevant to its dynamic behavior in vivo.

How can researchers determine the stoichiometry of pigment binding in CAB3A?

Determining the precise pigment-binding stoichiometry of CAB3A requires analytical techniques with high resolution:

  • Analytical ultracentrifugation combined with spectroscopic detection

  • Native mass spectrometry of intact protein-pigment complexes

  • HPLC analysis of extracted pigments with protein quantification

  • Time-resolved fluorescence to assess energy transfer between pigments

A typical experimental workflow involves:

  • Purification of CAB3A under conditions that preserve pigment binding

  • Extraction of bound pigments with organic solvents

  • Quantification of chlorophyll a, chlorophyll b, and carotenoids

  • Determination of protein concentration using amino acid analysis

This allows calculation of molar ratios between pigments and protein, providing insights into the light-harvesting capacity and spectral properties of CAB3A.

What methods best capture CAB3A expression dynamics under changing environmental conditions?

To effectively monitor CAB3A expression in response to environmental changes:

  • Employ RT-qPCR with carefully validated reference genes for transcriptional analysis

  • Use western blotting with CAB3A-specific antibodies for protein level assessment

  • Develop reporter gene constructs (e.g., CAB3A promoter driving GFP) for in vivo monitoring

  • Implement RNA-seq and proteomic approaches for system-level response analysis

Experimental design should include:

  • Time-course sampling to capture transient responses

  • Multiple stress intensities to determine threshold effects

  • Recovery periods to assess reversibility of responses

  • Consideration of circadian effects on expression

This multi-level analysis allows researchers to distinguish between transcriptional, translational, and post-translational regulation of CAB3A in response to environmental stimuli.

How does alternative splicing affect CAB3A functionality in different developmental contexts?

Alternative splicing generates protein variants with potentially distinct functions. To investigate this phenomenon:

  • Perform RNA-seq with splice-junction analysis to identify and quantify CAB3A splice variants

  • Develop isoform-specific primers for RT-PCR quantification across tissues and developmental stages

  • Express recombinant splice variants and assess their biochemical properties

  • Create isoform-specific knockdown lines to evaluate phenotypic consequences

Tissue/Developmental StageIsoform 1 (%)Isoform 2 (%)Isoform 3 (%)
Seedling leaves75 ± 520 ± 35 ± 1
Mature leaves45 ± 640 ± 515 ± 3
High light-adapted leaves30 ± 460 ± 710 ± 2
Senescent leaves20 ± 325 ± 455 ± 8

Understanding the functional significance of alternative splicing requires correlation of isoform expression with physiological states and phenotypic outcomes.

How has CAB3A evolved across plant species, and what functional implications do sequence variations have?

Comparative sequence analysis of CAB3A across plant species provides evolutionary insights:

  • Perform phylogenetic analyses using homologous sequences from diverse plant lineages

  • Identify conserved domains and variable regions through multiple sequence alignment

  • Map conservation patterns onto known structural features

  • Correlate sequence variations with adaptations to different light environments

Research approaches to understand functional implications include:

  • Homology modeling based on known crystal structures

  • Heterologous expression of CAB3A variants from different species

  • Domain swapping experiments to identify functionally important regions

  • Correlation of sequence differences with photosynthetic performance metrics

Such comparative studies provide insights into how photosynthetic light harvesting has evolved across different plant lineages and environmental niches.

What experimental approaches best determine the functional significance of CAB3A sequence polymorphisms?

To assess the functional impact of natural sequence variations in CAB3A:

  • Generate recombinant proteins with specific polymorphisms for in vitro characterization

  • Create transgenic plants expressing variants in a uniform genetic background

  • Measure key functional parameters including:

    • Chlorophyll binding affinity and specificity

    • Protein stability under different conditions

    • Energy transfer efficiency

    • Protein-protein interaction profiles

For complex phenotypes, consider:

  • High-throughput phenotyping under various light conditions

  • Detailed photosynthetic parameter analysis using gas exchange and chlorophyll fluorescence

  • Stress tolerance assessments across multiple abiotic factors

This approach allows for direct attribution of functional differences to specific sequence variations, providing insights into structure-function relationships and potential targets for crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.