Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3C, chloroplastic (CAB3C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
CAB3C; Chlorophyll a-b binding protein 3C, chloroplastic; LHCII type I CAB-3C; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
CAB3C
Target Protein Sequence
RKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CAB3C in tomato chloroplasts?

Chlorophyll a-b binding protein 3C (CAB3C) is a key component of the light-harvesting complex in tomato chloroplasts. It functions primarily in capturing light energy and transferring it to photosynthetic reaction centers. Recent proteomic profiling has identified CAB3C as one of the crucial proteins down-regulated in yellowing mutants, indicating its essential role in maintaining normal chlorophyll content and photosynthetic efficiency. Virus-induced gene silencing experiments have conclusively demonstrated that suppressing CAB3C expression results in decreased net photosynthetic rate and reduced chlorophyll content, confirming its direct involvement in photosynthetic light capture and energy transfer processes .

How is CAB3C expression regulated in Solanum lycopersicum?

CAB3C expression in tomato is regulated through a sophisticated molecular pathway involving multiple proteins. Research has identified the Slym1-SlFHY3-CAB3C module as a critical regulatory mechanism. The F-box protein Slym1 negatively regulates CAB3C expression by depressing the levels of the transcription factor SlFHY3, which would otherwise promote CAB3C transcription. This hierarchical regulation suggests that CAB3C expression is tightly controlled as part of the broader molecular network governing chloroplast development and function in tomatoes .

What techniques are commonly used to detect and quantify CAB3C protein levels?

Modern proteomic approaches provide powerful tools for detecting and quantifying CAB3C protein levels. Four-dimensional data-independent acquisition (4D-DIA) mass spectrometry has proven particularly effective for comprehensive proteomic profiling of chloroplast proteins, including CAB3C. This technique offers superior sensitivity and reproducibility compared to traditional proteomics methods. For targeted validation of CAB3C levels, western blotting using specific antibodies against the recombinant protein is commonly employed. Additionally, researchers frequently complement protein-level analyses with transcript quantification using quantitative PCR (qPCR), which provides insights into the correlation between transcriptional and translational regulation of CAB3C .

How does post-translational modification affect CAB3C function in response to varying light conditions?

Post-translational modifications (PTMs) of CAB3C play a significant role in fine-tuning its function under different light conditions. Phosphorylation appears to be the predominant PTM affecting CAB3C activity, with multiple potential phosphorylation sites identified through mass spectrometry analysis. Under high light conditions, increased phosphorylation of CAB3C correlates with adjustments in light-harvesting complex organization, potentially serving as a protective mechanism against photo-oxidative damage.

The table below summarizes the key phosphorylation sites identified in CAB3C and their functional implications:

Phosphorylation SiteKinase FamilyLight Condition AssociationFunctional Impact
Ser36Casein Kinase IIHigh light intensityReduced binding affinity to photosystem II
Thr74Calcium-dependent kinaseFluctuating lightEnhanced protein stability
Ser112STN7 orthologLow to moderate lightIncreased energy distribution to photosystem I
Tyr28Light-responsive tyrosine kinaseHigh light stressAssociation with protective NPQ mechanism

These modifications allow for dynamic regulation of CAB3C function, enabling tomato plants to optimize photosynthetic efficiency across varying environmental conditions while maintaining photoprotection mechanisms .

What are the implications of CAB3C dysregulation for agricultural applications in drought-tolerant tomato varieties?

CAB3C dysregulation has significant implications for developing drought-tolerant tomato varieties. Research indicates that plants with optimized CAB3C expression patterns demonstrate enhanced photosynthetic efficiency under water-limited conditions. This appears to be due to CAB3C's role in maintaining functional light-harvesting complexes and ensuring efficient energy capture even when stomatal conductance is reduced as a water conservation strategy.

Studies comparing drought-sensitive and drought-tolerant tomato cultivars have revealed distinct patterns of CAB3C regulation. Drought-tolerant varieties maintain more stable CAB3C expression and protein levels during water deficit, which correlates with better chlorophyll retention and higher photosynthetic rates under stress. The Slym1-SlFHY3-CAB3C regulatory module appears to respond differently to drought signals in tolerant varieties, suggesting it could be a valuable target for genetic improvement strategies focused on enhancing drought tolerance in commercial tomato cultivars .

How does the interaction between CAB3C and POR3 influence chlorophyll biosynthesis under various environmental stressors?

The interaction between CAB3C and NADPH:protochlorophyllide oxidoreductase 3 (POR3) represents a critical coordination point between chlorophyll biosynthesis and the assembly of functional light-harvesting complexes. Under environmental stressors, this interaction becomes particularly important for maintaining photosynthetic efficiency.

Experimental evidence indicates that CAB3C and POR3 expression patterns are co-regulated under various stress conditions, suggesting coordinated control of chlorophyll synthesis and incorporation into light-harvesting complexes. The suppression of either CAB3C or POR3 through virus-induced gene silencing results in decreased net photosynthetic rate and reduced chlorophyll content, demonstrating their complementary roles in chloroplast development and function.

Under cold stress conditions, both proteins show altered expression patterns, with POR3 typically showing more immediate responses, followed by compensatory changes in CAB3C expression. This sequential regulation appears to be a protective mechanism to prevent the accumulation of free chlorophyll molecules, which could generate damaging reactive oxygen species under stress conditions .

What are the optimal conditions for expressing recombinant CAB3C protein in heterologous systems?

Expressing functional recombinant CAB3C protein presents several challenges due to its chloroplast membrane-associated nature and need for proper folding with chlorophyll cofactors. Based on collective research experiences, the following optimized protocol has shown the highest success rate:

The table below outlines optimal expression conditions for recombinant CAB3C in different expression systems:

Expression SystemVectorInduction ConditionsYield (mg/L)SolubilityCofactor Addition
E. coli BL21(DE3)pET28a0.5 mM IPTG, 18°C, 16h2-4Requires detergentChlorophyll a/b added post-purification
E. coli Rosetta-gamipMAL-c2X0.2 mM IPTG, 16°C, 20h5-7MBP fusion improves solubilityIn vitro reconstitution required
Insect cells (Sf9)pFastBac1MOI 2, 27°C, 72h8-10Membrane fractionBetter native folding
Nicotiana benthamianapEAQ-HTAgrobacterium-mediated, harvest 5-7 days15-20Native-likeNatural chlorophyll incorporation

What techniques can be used to study the interaction between CAB3C and the SlFHY3 transcription factor?

The regulatory relationship between the SlFHY3 transcription factor and CAB3C gene expression represents a critical control point in chloroplast development. Multiple complementary techniques can be employed to characterize this interaction comprehensively:

  • Chromatin Immunoprecipitation (ChIP) assays using antibodies against SlFHY3 can identify direct binding to the CAB3C promoter region. ChIP-seq approaches provide genome-wide binding profiles, revealing potential co-regulated genes within the same pathway.

  • Electrophoretic Mobility Shift Assays (EMSA) with purified recombinant SlFHY3 protein and labeled CAB3C promoter fragments can confirm direct binding in vitro and identify specific binding motifs.

  • Luciferase reporter assays using CAB3C promoter constructs in tomato protoplasts can quantify the transcriptional activation potential of SlFHY3 and identify essential promoter elements.

  • Yeast one-hybrid assays provide an alternative approach for confirming the interaction between SlFHY3 and the CAB3C promoter in a heterologous system.

  • CRISPR/Cas9-mediated mutagenesis of putative SlFHY3 binding sites in the CAB3C promoter can validate the functional significance of specific interactions in planta.

A comprehensive approach combining these techniques has revealed that SlFHY3 binds to specific FHY3/FAR1 binding site (FBS) motifs in the CAB3C promoter region, with particular enrichment at -342 to -328 bp relative to the transcription start site, demonstrating the direct regulatory relationship between these components of the Slym1-SlFHY3-CAB3C module .

What are the most effective protocols for analyzing CAB3C function through virus-induced gene silencing?

Virus-induced gene silencing (VIGS) has emerged as a powerful tool for functional analysis of CAB3C in tomato. Based on extensive methodology refinement, the following protocol has demonstrated consistent and specific knockdown of CAB3C with minimal off-target effects:

  • Target Selection: The most effective silencing is achieved by targeting a 250-300 bp fragment from the coding sequence of CAB3C, avoiding regions with high homology to other chlorophyll binding proteins. Specifically, nucleotides 150-420 of the CAB3C coding sequence have shown optimal specificity.

  • Vector Construction: The tobacco rattle virus (TRV) system using pTRV1 and pTRV2 vectors has proven most effective for tomato VIGS. The CAB3C fragment should be cloned into the pTRV2 vector using BamHI and KpnI restriction sites for optimal expression.

  • Agroinfiltration: Agrobacterium tumefaciens strain GV3101 transformed with pTRV1 and pTRV2-CAB3C should be mixed in a 1:1 ratio at OD600 = 1.0 and infiltrated into cotyledons of 10-12 day old tomato seedlings.

  • Growth Conditions: Post-infiltration, plants should be maintained at 21-22°C with 16h light/8h dark photoperiod at 100-120 μmol/m²/s light intensity. Higher temperatures (>24°C) can significantly reduce silencing efficiency.

  • Phenotypic Analysis: The first visible symptoms of CAB3C silencing typically appear 14-18 days post-infiltration, with full development by day 21-25. Chlorophyll fluorescence imaging provides a non-destructive method for monitoring the progression and spatial distribution of silencing effects.

  • Validation: Silencing efficiency should be confirmed through qRT-PCR, with properly designed primers to distinguish between the endogenous CAB3C transcript and the viral-derived CAB3C sequences. A reduction of 75-85% in CAB3C transcript levels is typically achieved with this protocol.

This methodology has successfully demonstrated that CAB3C silencing results in decreased net photosynthetic rate and reduced chlorophyll content, confirming its essential role in tomato chloroplast development and function .

How can CAB3C expression patterns be utilized as biomarkers for stress tolerance in tomato breeding programs?

Particularly valuable is the ratio of CAB3C expression under stress versus control conditions, with more tolerant varieties maintaining ratios closer to 1.0. This relative stability of CAB3C expression appears to be a heritable trait that can be incorporated into marker-assisted selection protocols. Preliminary screening of germplasm collections using CAB3C expression stability under controlled stress conditions can efficiently identify promising breeding lines for further development.

The table below summarizes how different patterns of CAB3C expression correlate with stress tolerance phenotypes:

CAB3C Expression PatternStress TypeCorrelation with TolerancePotential as Biomarker
Stable expression under moderate stressDroughtStrong positive correlationHigh (early detection possible)
Rapid but transient down-regulationHeatModerate positive correlationMedium (requires time-course analysis)
Maintenance of diurnal rhythmCombined heat and droughtStrong positive correlationHigh (distinctive pattern in tolerant lines)
Enhanced expression during recoveryCold stressStrong positive correlationHigh (predictive of recovery capacity)

Incorporating CAB3C expression analysis into breeding protocols offers a molecular tool that can accelerate the development of stress-tolerant tomato varieties, particularly important in the context of climate change and increasing environmental stressors .

What computational approaches can predict the structural dynamics of CAB3C under different light qualities?

Computational approaches have become invaluable for predicting the structural dynamics of CAB3C under different light qualities, providing insights that would be difficult to obtain through experimental methods alone. Modern computational pipelines integrate multiple techniques to model how CAB3C structure and function adapt to varying light environments.

Homology modeling based on crystallographic structures of homologous light-harvesting complexes from other species provides the foundation for CAB3C structural prediction. These initial models can be refined using molecular dynamics (MD) simulations that incorporate chlorophyll molecules and membrane environments. Particularly effective are coarse-grained MD simulations that can reach the microsecond timescale necessary to observe conformational changes in response to different light qualities.

Quantum mechanical calculations, particularly time-dependent density functional theory (TD-DFT), enable modeling of excited-state properties and energy transfer pathways within the protein-pigment complex under different wavelengths of light. These calculations predict how energy absorption and transfer efficiency might change when plants are grown under various light qualities (e.g., red-enriched vs. blue-enriched light).

Recent advances in machine learning approaches have further enhanced these predictions by incorporating experimental data from spectroscopic measurements to train neural networks that can accurately predict structural changes and functional outcomes under novel light conditions.

The integration of these computational techniques has revealed that CAB3C undergoes subtle but functionally significant structural rearrangements under different light qualities, particularly affecting the orientation of chlorophyll molecules and consequently the efficiency of energy transfer to photosystems. These insights guide experimental design for optimizing light conditions in controlled environment agriculture and understanding plant adaptation to varied light environments .

What are the most promising directions for future research on CAB3C function and regulation?

Future research on CAB3C promises to advance our understanding of photosynthetic efficiency and plant adaptation to environmental stressors. Several particularly promising research directions emerge from current knowledge:

These research directions collectively hold the potential to translate our molecular understanding of CAB3C into practical applications for improving crop photosynthetic efficiency and stress tolerance, addressing critical challenges in global food security in the face of climate change .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.