Recombinant Solanum lycopersicum Chlorophyll a-b binding protein CP24 10B, chloroplastic (CAP10B)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosynthesis

CAP10B plays dual roles in light harvesting and photoprotection:

  • Light Harvesting: Transfers excitation energy from peripheral antennae (e.g., LHCII) to PSII reaction centers .

  • Xanthophyll Binding: Selectively binds violaxanthin and lutein, critical for non-photochemical quenching (NPQ) under high light .

  • Structural Stability: Stabilizes PSII-LHCII supercomplexes; knockout mutants show disorganized grana membranes and reduced electron transport rates .

Studies on Arabidopsis CP24 mutants revealed:

  • 30% reduction in PSII efficiency due to LHCII-PSII decoupling .

  • Impaired NPQ capacity and ΔpH gradient, limiting growth under fluctuating light .

Production Methodology

  • Expression System: E. coli-derived apoprotein refolded in vitro with chlorophylls and xanthophylls .

  • Reconstitution: Achieves native-like spectral properties, with absorption peaks at 638–686 nm depending on chlorophyll a/b ratio .

Research Applications

ApplicationUse CaseSource
SpectroscopyStudying chlorophyll-protein interactions via Gaussian deconvolution PubMed
Mutant AnalysisInvestigating PSII organization in CP24 knockout plants PMC
Antibody DevelopmentTarget validation for Western blotting (Anti-Lhcb6 antibody) Agrisera
Stress Response StudiesAnalyzing violaxanthin-zeaxanthin cycling under high light PubMed

Comparative Analysis of Native vs. Recombinant CAP10B

FeatureNative CAP10BRecombinant CAP10B
SourcePlant thylakoid membranesE. coli expression system
StabilityProne to degradation during isolation Stable in lyophilized form
Xanthophyll SelectivityBinds violaxanthin and lutein Retains native binding specificity
Chlorophyll a/b RatioFixed in vivoAdjustable during reconstitution

Challenges and Innovations

  • Instability: Native CP24 is labile, but recombinant forms enable reproducible studies .

  • Plasticity: Tolerates high chlorophyll b content (up to 8:1 b:a ratio) without structural loss .

  • Agricultural Relevance: CP24 mutants exhibit stunted growth, highlighting its role in crop resilience .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
CAP10B; Chlorophyll a-b binding protein CP24 10B, chloroplastic; CAB-10B; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-256
Protein Length
Full Length of Mature Protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
CAP10B
Target Protein Sequence
AAAVAPKKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGR WAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDN DSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLA EIKHSRLAMLAMLIFYFEAGQGKTPLGALGL
Uniprot No.

Target Background

Database Links
Protein Families
ELIP/psbS family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary function of CAP10B in tomato chloroplasts?

CAP10B functions as a light-harvesting antenna protein that collects solar energy and transfers it to photosynthetic reaction centers. As a component of the photosystem II antenna system, it specifically binds chlorophyll molecules and carotenoids, particularly violaxanthin and lutein. Its primary role involves regulating the excited state concentration of chlorophyll a, which is crucial for efficient photosynthetic energy transfer . Additionally, CAP10B participates in photoprotective mechanisms that help dissipate excess energy under high light conditions, preventing photooxidative damage to the photosynthetic apparatus.

How does the chlorophyll-binding pattern of CAP10B differ from other light-harvesting complex proteins?

The chlorophyll-binding pattern of CAP10B shows distinct characteristics compared to other light-harvesting complex proteins. Each CAP10B monomer binds approximately 10 chlorophyll a and chlorophyll b molecules in total, along with two xanthophyll molecules . Unlike other light-harvesting proteins, CP24 demonstrates higher plasticity in xanthophyll binding and can refold in the absence of lutein, which is typically essential for the assembly of other homologous proteins . This unique property suggests CAP10B has evolved specialized flexibility in its pigment-binding sites, potentially related to its role in binding zeaxanthin during high light stress conditions.

What spectroscopic signatures characterize purified CAP10B protein?

Purified CAP10B protein exhibits distinctive spectroscopic signatures that reflect its pigment composition and arrangement. Spectroscopic analysis using Gaussian deconvolution has identified specific absorption subbands for chlorophyll b at wavelengths of 638, 645, 653, and 659 nm . The chlorophyll a component shows characteristic absorption peaks at 666, 673, 679, and 686 nm, which become depleted in recombinant proteins engineered to have higher chlorophyll b content . These spectral features serve as fingerprints for validating properly folded recombinant CAP10B and can be used to assess the quality of protein preparations. The precise wavelength positions of these absorption bands provide insights into the local protein environment surrounding each chlorophyll molecule.

What expression systems are most effective for producing recombinant CAP10B?

For recombinant CAP10B production, bacterial expression systems, particularly E. coli, have proven effective when the focus is on obtaining the apoprotein (protein without pigments) . The procedure typically involves cloning the Lhcb6 cDNA (encoding CAP10B) into a suitable expression vector, followed by transformation into an E. coli strain optimized for recombinant protein production. For optimal expression, induction conditions should be carefully controlled, using IPTG at concentrations between 0.4-1.0 mM when the culture reaches an OD600 of 0.6-0.8, with expression typically conducted at lower temperatures (16-25°C) to enhance proper folding. Inclusion bodies containing the expressed apoprotein are then isolated through cell lysis followed by centrifugation steps, which can be subsequently used for in vitro reconstitution with pigments.

What are the key challenges in purifying native CAP10B from plant tissue?

Purifying native CAP10B from plant tissue presents several significant challenges that have historically limited its characterization. The protein is notoriously difficult to isolate due to its low abundance relative to other photosystem components and its instability during conventional purification procedures . Extraction typically requires careful solubilization of thylakoid membranes using mild detergents (such as n-dodecyl-β-D-maltoside or digitonin) without disrupting the native protein conformation. The protein's tight association with other photosystem II components further complicates isolation of pure CAP10B. Additionally, the protein's sensitivity to proteolytic degradation necessitates working at low temperatures with protease inhibitors throughout the purification process. These challenges explain why researchers have increasingly turned to recombinant protein approaches for studying CAP10B structure and function .

How can researchers optimize the in vitro reconstitution of CAP10B with pigments?

Optimizing in vitro reconstitution of CAP10B with pigments requires careful attention to multiple factors. The procedure typically begins with solubilizing the purified apoprotein in denaturing conditions (often 8M urea) containing appropriate detergents (typically lithium dodecyl sulfate). Pigments (chlorophylls and carotenoids) extracted from plant material or purchased as purified compounds should be added at specific molar ratios to the denatured protein . The reconstitution mixture should then undergo controlled removal of the denaturant through dialysis or dilution to allow proper protein refolding and pigment binding. Critical factors affecting reconstitution efficiency include the pH (typically 7.5-8.0), temperature (usually performed at 4°C), the chlorophyll a/b ratio in the reconstitution mixture, and the types of carotenoids provided . The success of reconstitution can be monitored through absorption spectroscopy, comparing the spectral properties with those of the native protein isolated from maize thylakoids .

How does varying the chlorophyll a/b ratio affect CAP10B folding and function?

When reconstituted with higher proportions of chlorophyll b, spectroscopic analysis reveals enhanced absorption in the 638-659 nm region (characteristic of chlorophyll b), while proteins with higher chlorophyll a content show stronger absorption in the 666-686 nm range . This flexibility likely serves a physiological purpose, allowing plants to adjust the spectral absorption properties of their light-harvesting apparatus in response to changing light conditions. The impact on energy transfer efficiency would vary based on the precise arrangement of chlorophylls within the protein scaffold, affecting the rate and pathways of excitation energy transfer between pigments.

What molecular mechanisms explain CAP10B's selective binding of violaxanthin and lutein over other carotenoids?

The selective binding of violaxanthin and lutein by CAP10B over other carotenoids like neoxanthin and beta-carotene is determined by specific structural features of both the protein binding pockets and the carotenoids themselves. The recombinant holoprotein exhibits high selectivity in xanthophyll binding despite being supplied with a mixture of carotenoids during refolding . This selectivity likely stems from:

  • Binding pocket architecture: The carotenoid-binding sites in CAP10B likely contain specific amino acid residues that form hydrogen bonds with the hydroxyl groups present in violaxanthin and lutein, but absent in beta-carotene.

  • Structural complementarity: The specific lengths and conformations of violaxanthin and lutein may provide optimal fit within the binding pockets of CAP10B.

  • Functional requirements: The selective binding reflects the evolutionary adaptation of CAP10B to participate in the xanthophyll cycle, where violaxanthin is converted to zeaxanthin under high light stress .

This selective binding capability is crucial for CAP10B's role in photoprotection during high light conditions, as it positions these xanthophylls optimally for energy dissipation through non-photochemical quenching.

How do mutations in key binding sites affect the spectroscopic properties and energy transfer efficiency of CAP10B?

Mutations in key binding sites of CAP10B can profoundly alter its spectroscopic properties and energy transfer efficiency through several mechanisms. When amino acids involved in coordinating chlorophyll molecules are altered, the resulting changes in the local protein environment can shift absorption maxima by altering the energetic states of bound pigments. For example, mutations affecting the ligands to the central Mg2+ atom of chlorophyll molecules typically cause significant red or blue shifts in absorption peaks.

Mutations affecting carotenoid binding sites can disrupt the protein's ability to selectively bind violaxanthin and lutein, potentially altering its capacity to participate in photoprotective mechanisms . This is particularly relevant given CAP10B's unusual capability to refold in the absence of lutein, unlike other homologous proteins that strictly require this carotenoid for proper assembly .

Energy transfer efficiency between chlorophylls is highly dependent on the precise distances and orientations between donor and acceptor molecules. Mutations that alter these parameters, even subtly, can significantly change the rates of energy transfer. This can be measured experimentally through time-resolved fluorescence spectroscopy, which would reveal altered fluorescence lifetimes and quantum yields in mutant proteins compared to wild-type CAP10B.

What are the optimal conditions for studying CAP10B-mediated energy transfer using time-resolved spectroscopy?

Studying CAP10B-mediated energy transfer using time-resolved spectroscopy requires careful optimization of multiple experimental parameters. For femtosecond transient absorption spectroscopy, samples should be prepared at chlorophyll concentrations of 20-30 µg/ml in buffer containing appropriate detergent concentrations to prevent protein aggregation while maintaining native-like protein conformations. The sample should be continuously stirred during measurements to prevent photodamage from the excitation pulses.

Optimal excitation wavelengths would target specific pigments: 650 nm for preferential excitation of chlorophyll b, 675 nm for chlorophyll a, and 490-510 nm for carotenoid excitation. The probe wavelength range should cover 650-750 nm to monitor energy transfer between different chlorophyll species. Temperature control is crucial, with measurements typically performed at both physiological temperatures (20-25°C) and cryogenic temperatures (77K) to freeze certain energy transfer steps for more detailed analysis.

Data analysis should employ global and target analysis approaches to resolve the complex kinetics of multiple energy transfer pathways within CAP10B. Comparison with the spectroscopic features identified through Gaussian deconvolution of steady-state absorption spectra (showing chlorophyll b peaks at 638, 645, 653, and 659 nm, and chlorophyll a peaks at 666, 673, 679, and 686 nm) enables assignment of energy transfer pathways between specific pigment sites .

How can researchers distinguish between conformational changes in CAP10B induced by different xanthophyll bindings?

Distinguishing between conformational changes in CAP10B induced by different xanthophyll bindings requires a multi-technique approach. Circular dichroism (CD) spectroscopy in both the far-UV region (190-250 nm) and the visible region (400-700 nm) can detect alterations in protein secondary structure and pigment-pigment interactions, respectively. Proteins reconstituted with different xanthophylls (violaxanthin versus lutein) typically show distinct CD signatures, particularly in the 450-550 nm region where carotenoid absorption dominates.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers another powerful approach, as regions of the protein that undergo conformational changes upon binding different xanthophylls will show altered rates of hydrogen exchange. This technique can pinpoint specific domains within CAP10B that respond differently to violaxanthin versus lutein binding.

Förster resonance energy transfer (FRET) measurements between strategically placed fluorescent labels can detect changes in distances between different domains of the protein when bound to different xanthophylls. Additionally, molecular dynamics simulations based on available structural data can predict conformational changes induced by different carotenoids, generating testable hypotheses for experimental validation.

What analytical approaches can resolve contradictory data on CAP10B pigment stoichiometry from different experimental methods?

Resolving contradictory data on CAP10B pigment stoichiometry from different experimental methods requires systematic investigation using complementary analytical approaches. A comprehensive strategy includes:

  • HPLC analysis with improved extraction protocols: Implement sequential extraction procedures using different solvent systems to ensure complete pigment extraction. Standard curves should be generated using authenticated pigment standards, and multiple internal standards should be included to account for extraction efficiency variations across pigment classes.

  • Cross-validation with multiple spectroscopic methods: Compare results from absorption spectroscopy, fluorescence excitation spectra, and resonance Raman spectroscopy. Each technique offers different sensitivity to specific pigments and can help identify discrepancies in quantification.

  • Controlled reconstitution experiments: Perform in vitro reconstitution with precisely defined pigment ratios, then analyze the resulting holoprotein to establish the relationship between input ratios and final bound pigments. This approach has already demonstrated that each CAP10B monomer binds a total of 10 chlorophyll molecules plus two xanthophyll molecules .

  • Mass spectrometry of intact protein-pigment complexes: Native mass spectrometry can determine the exact mass of the entire complex, which, when compared with the known mass of the apoprotein, can indicate the number and types of bound pigments.

  • Statistical analysis of data from multiple preparations: Analyzing data from multiple independent protein preparations using statistical methods like ANOVA can identify sources of variation and establish confidence intervals for pigment stoichiometry.

When contradictions persist, researchers should consider reporting ranges rather than absolute values for pigment stoichiometry and explicitly discuss methodological limitations that might contribute to the observed discrepancies.

How does CAP10B contribute to photoprotection during high light stress in tomato plants?

CAP10B plays a sophisticated role in photoprotection during high light stress in tomato plants through multiple interconnected mechanisms. Under high light conditions, excess excitation energy can lead to the formation of reactive oxygen species that damage the photosynthetic apparatus. CAP10B contributes to preventing this damage through:

  • Xanthophyll cycle participation: The protein's ability to bind violaxanthin positions this pigment for enzymatic conversion to zeaxanthin during high light stress . This conversion is central to non-photochemical quenching (NPQ), a process that safely dissipates excess excitation energy as heat.

  • Structural flexibility: Unlike other light-harvesting proteins, CAP10B demonstrates higher plasticity in xanthophyll binding, including the ability to refold in the absence of lutein . This unusual flexibility may allow CAP10B to accommodate structural changes needed during the transition between light-harvesting and photoprotective states.

  • Energy redistribution: CAP10B likely participates in the reorganization of photosystem II under high light, helping to transfer energy away from vulnerable reaction centers to be dissipated as heat.

  • Signaling involvement: The protein may participate in signaling cascades that activate photoprotective gene expression, coordinating the longer-term acclimation response to high light conditions.

These photoprotective functions are particularly important in crop plants like tomato, which are often cultivated in high-light environments where photoprotection efficiency directly impacts agricultural productivity.

What regulatory mechanisms control CAP10B expression and assembly in response to changing light conditions?

CAP10B expression and assembly are regulated by sophisticated mechanisms that respond to changing light conditions, ensuring photosynthetic efficiency across varying environments. At the transcriptional level, the Lhcb6 gene (encoding CAP10B) is regulated by multiple light-responsive elements in its promoter region. These elements bind transcription factors that integrate signals from photoreceptors (particularly phytochromes and cryptochromes) with the plant's circadian clock and developmental programs.

Post-transcriptionally, microRNAs and RNA-binding proteins modulate Lhcb6 mRNA stability and translation efficiency in response to light quality and intensity. At the protein level, CAP10B undergoes several regulatory modifications:

  • Import into chloroplasts is regulated by the translocon machinery, which can be modified by light signaling pathways.

  • Assembly into functional complexes requires coordinated synthesis of pigments (chlorophylls and carotenoids) and is facilitated by specialized chaperones whose activity is light-regulated.

  • Phosphorylation of CAP10B by light-activated kinases alters its association with photosystem II, affecting energy distribution between photosystems.

  • Under prolonged high light stress, controlled degradation of CAP10B through chloroplast proteases helps restructure the photosynthetic apparatus for better photoprotection.

These multi-layered regulatory mechanisms ensure that CAP10B levels and activity are precisely tuned to prevailing light conditions, optimizing photosynthetic efficiency while minimizing photodamage risk.

How do interactions between CAP10B and other photosystem II proteins change during state transitions?

During state transitions, a short-term adaptation mechanism that balances excitation energy between photosystems I and II, the interactions between CAP10B and other photosystem II proteins undergo dynamic changes. State transitions are triggered by changes in the redox state of the plastoquinone pool, which activate specific kinases that phosphorylate light-harvesting proteins.

When CAP10B becomes phosphorylated during the transition to State 2 (when more energy is directed to photosystem I), several interaction changes occur:

These dynamic interaction changes effectively reduce the absorption cross-section of photosystem II while potentially increasing that of photosystem I, representing a rapid adaptive response to changing light conditions. The plasticity of CAP10B in xanthophyll binding may contribute to its functional flexibility during these transitions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.