Recombinant Solanum lycopersicum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Solanum lycopersicum (tomato) Chloroplast Envelope Membrane Protein (cemA) is a genetically engineered variant of the native cemA protein, expressed in heterologous systems for functional and structural studies. cemA is an integral membrane protein localized to the inner chloroplast envelope, with roles in ion transport and chloroplast biogenesis . Its recombinant form enables detailed biochemical and biophysical analyses, advancing research on chloroplast physiology.

Role in Chloroplast Physiology

  • CO₂ Transport: CemA homologs in cyanobacteria (e.g., Synechocystis cotA) facilitate CO₂ uptake, critical for photosynthetic efficiency .

  • Proton Extrusion: Indirectly supports inorganic carbon uptake into chloroplasts by regulating proton gradients .

  • Membrane Integration: Unlike most chloroplast-encoded proteins targeting thylakoids, cemA localizes to the inner envelope membrane, suggesting unique insertion mechanisms .

Expression System

  • Host: Optimized for E. coli cell-free expression systems to retain native folding .

  • Purification: Affinity chromatography via His tag, followed by size-exclusion chromatography for homogeneity .

Reconstitution Protocol

  • Buffer: Reconstitute in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

Functional Studies

  • Transport Assays: Used to characterize CO₂/HCO₃⁻ transport kinetics in synthetic lipid bilayers .

  • Protein-Protein Interactions: Identified associations with translocon components (e.g., TIC-TOC machinery) via co-immunoprecipitation .

Phenotypic Impact of cemA Knockout

  • Chloroplast Defects: Disruption of cemA in Arabidopsis leads to impaired thylakoid membrane organization and seedling lethality .

  • Carbon Uptake Deficiency: Synechocystis mutants with defective cotA (cemA homolog) show reduced CO₂ transport activity .

Evolutionary Conservation

  • Cross-Species Homology: CemA shares 60–70% sequence identity with cyanobacterial cotA and Arabidopsis homologs, underscoring conserved roles in CO₂ metabolism .

Challenges and Future Directions

  • Membrane Integration Mechanisms: Elucidate how cemA’s TMS domains engage envelope-specific translocons .

  • Biotechnological Applications: Engineer cemA variants to enhance photosynthetic efficiency in crops under high CO₂ conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKWLESWVTNWWNTGQSQIVLNNIQEKSLLEKF RELEELLFLDEMIKEYSETHLEEFGIGIHKETIQLITIQNENRMDTILHFSTNIIWFGIL SGYSILGKEKLVILNSWAQEFLYNLSDTAKALCILLVSEFFLGYHSPPGWEFVIRSIYNE VGVVANEQTITILVCILPVIFDTCFKYWLFRYLTSLSPSILLLYDSITE
Uniprot No.

Target Background

Function

May be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.

Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the cemA gene in tomato?

The cemA gene (Solyc07g042820.2) in Solanum lycopersicum is located in the chloroplast genome. The gene spans 9,192 bp and is known by the synonym ycf10 . Like other chloroplast genes, it is subject to prokaryotic-like expression mechanisms. The expression of cemA can be monitored through platforms like the Tomato Expression Database (TED), which contains normalized and processed data for gene expression during fruit development and ripening .

What are the optimal conditions for expressing recombinant cemA protein?

When expressing recombinant cemA protein from Solanum lycopersicum, the following parameters should be considered:

  • Expression system selection: Due to cemA being a chloroplast membrane protein, specialized expression systems that can handle membrane proteins are recommended. E. coli-based systems with specific membrane protein expression enhancements or chloroplast-based expression systems in model plants may be suitable.

  • Temperature and induction conditions: Expression should be conducted at lower temperatures (16-20°C) to promote proper folding of this membrane protein.

  • Solubilization and purification: Use appropriate detergents for membrane protein extraction and purification. Typical buffers include:

Buffer ComponentConcentrationPurpose
Tris-HCl (pH 7.5-8.0)50 mMMaintains pH
NaCl150-300 mMProvides ionic strength
Glycerol10-20%Enhances protein stability
Mild detergent (DDM, LDAO)0.5-1%Solubilizes membrane protein
Protease inhibitorsAs recommendedPrevents degradation
  • Storage conditions: For long-term storage, maintain in Tris-based buffer with 50% glycerol at -20°C or -80°C to prevent repeated freeze-thaw cycles .

What approaches are most effective for studying cemA function in tomato chloroplasts?

Several complementary approaches can be used to study cemA function:

  • Genetic manipulation techniques:

    • CRISPR/Cas9-mediated knockout: To generate loss-of-function mutants by targeting the cemA gene, similar to approaches used for other chloroplast-related genes like SlRCM1 .

    • Chloroplast transformation: Using biolistic methods for direct modification of the chloroplast genome in tomato cultivars. This may require optimization based on cultivar regeneration potential .

  • Expression analysis:

    • RT-qPCR for measuring transcription levels

    • Western blotting for protein detection using specific antibodies

    • Digital expression analysis through platforms like TED

  • Localization studies:

    • GFP fusion proteins to confirm chloroplast membrane localization

    • Immunogold electron microscopy for precise subcellular localization

  • Functional assays:

    • Measurement of proton flux across chloroplast membranes

    • Photosynthetic efficiency measurements

    • Chlorophyll content analysis during fruit development stages

How can I optimize chloroplast transformation protocols for cemA studies in different tomato cultivars?

Based on chloroplast transformation studies in tomato:

  • Cultivar selection: Select tomato cultivars with high regeneration potential. Studies have shown varying regeneration efficiency among cultivars, with Green Pineapple, Pusa Ruby, and Yellow Currant demonstrating better response to chloroplast transformation .

  • Vector design: Use chloroplast transformation vectors with proper selective markers. The pRB94 vector containing a chimeric aadA selectable marker gene controlled by the rRNA operon promoter (Prrn) provides resistance to spectinomycin and streptomycin, which is useful for selection .

  • Transformation method optimization:

    • Biolistic delivery parameters: Optimize pressure, distance, and microparticle properties

    • Explant selection: Properly selected leaf explants have shown better transformation efficiency

    • Selection media: Use 50 mg/L selection media containing spectinomycin and streptomycin for selecting transformants

  • Regeneration conditions: Control temperature (20-25°C), relative humidity (70-80%), and light conditions (16-hour photoperiod) to maximize regeneration of transformed tissues .

  • Homoplasmy achievement: Perform multiple rounds of selection to achieve homoplasmic status, as initial transformants are often heteroplasmic .

How can cemA be utilized in enhancing chloroplast function or stress tolerance in tomatoes?

Recombinant cemA protein can be leveraged for several advanced applications:

  • Enhancing photosynthetic efficiency: Modifying cemA expression or structure may optimize proton gradient formation across the chloroplast membrane, potentially improving photosynthetic efficiency.

  • Stress tolerance engineering: As a membrane protein, cemA could be modified to enhance chloroplast integrity under stress conditions like high temperature or drought, similar to how nano-CeO2 treatments have been shown to mitigate effects of Fusarium infestation in tomatoes .

  • Biofortification strategies: Manipulating cemA function could potentially affect chloroplast development and indirectly impact nutrient accumulation in tomato fruits. This approach could complement other biofortification strategies for enhancing nutritional qualities.

  • Reporter systems: The cemA gene promoter could be utilized to develop reporter systems for monitoring chloroplast development and response to environmental conditions, similar to systems developed for studying anthocyanin production in tomatoes .

What interactions does cemA have with other chloroplast proteins and how can these interactions be studied?

CemA likely participates in protein-protein interactions within the chloroplast envelope that are crucial for its function. These interactions can be studied using:

  • Co-immunoprecipitation (Co-IP): Using antibodies against cemA to pull down interaction partners, followed by mass spectrometry identification.

  • Yeast two-hybrid (Y2H) or split-luciferase assays: Similar to those used to study protein interactions in tomato anthocyanin synthesis pathways . For membrane proteins like cemA, modified approaches such as membrane Y2H may be necessary.

  • Bimolecular Fluorescence Complementation (BiFC): To visualize protein interactions in vivo within plant cells.

  • Protein crosslinking followed by mass spectrometry: To capture transient interactions within the chloroplast membrane environment.

  • Computational predictions and molecular modeling: To identify potential interaction partners based on protein structure and conservation patterns.

How does cemA expression vary during tomato fruit development and ripening?

Understanding cemA expression patterns requires:

  • Developmental stage analysis: Monitor cemA expression across multiple fruit development stages (green, breaker, turning, red ripe) using RT-qPCR and western blotting.

  • Digital expression analysis: Utilize resources like the Tomato Digital Expression Database to examine cemA expression across different tissues and developmental stages .

  • Influence of environmental factors: Investigate how cemA expression responds to different growth conditions:

Environmental FactorTemperature RangeLight ConditionsGrowth StageExpected cemA Expression Response
Temperature10-35°CNormal lightVegetativeModerate changes based on photosynthetic needs
Temperature20-25°CNormal lightFruit developmentPotential upregulation during chloroplast development
Light intensity20-25°CHigh lightVegetativePotential upregulation for photoprotection
Light intensity20-25°CLow lightVegetativePotential downregulation
  • Response to ripening-related hormones: Assess how ethylene and other ripening-related hormones affect cemA expression, similar to studies conducted with ripening mutants like Never-ripe (Nr) .

What are the main challenges in purifying functional recombinant cemA protein and how can they be addressed?

Membrane proteins like cemA present specific purification challenges:

  • Solubilization difficulties:

    • Challenge: Maintaining protein structure during extraction from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations to identify optimal solubilization conditions without denaturing the protein

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Use specialized expression strains designed for membrane proteins; consider fusion tags that enhance solubility; optimize codon usage for the expression host

  • Protein stability issues:

    • Challenge: Maintaining stability during purification steps

    • Solution: Include stabilizing agents (glycerol, specific lipids) in purification buffers; conduct purification at 4°C; consider adding specific cofactors if known

  • Functional verification:

    • Challenge: Confirming that purified protein retains native activity

    • Solution: Develop specific functional assays for proton transport; consider reconstitution into liposomes to test membrane-associated functions

How can I troubleshoot failed chloroplast transformation attempts when working with cemA?

When chloroplast transformation attempts fail:

  • Explant selection and preparation:

    • Issue: Selecting suboptimal leaf material

    • Solution: Use young, fully expanded leaves from plants grown under optimal conditions; ensure sterile technique throughout

  • Bombardment parameters:

    • Issue: Insufficient DNA delivery to chloroplasts

    • Solution: Optimize particle size, helium pressure, and target distance; ensure even coating of gold particles with DNA

  • Selection challenges:

    • Issue: Difficulty identifying positive explants among dead-appearing tissues

    • Solution: Implement a systematic approach to identify subtle signs of resistance; adjust antibiotic concentration if necessary; consider using visual markers alongside selection markers

  • Heteroplasmy persistence:

    • Issue: Failure to achieve homoplasmy

    • Solution: Conduct multiple rounds of selection and regeneration; test multiple explants from the same transformation event; use molecular techniques to quantify wild-type vs. transformed plastid genomes

  • Regeneration difficulties:

    • Issue: Poor regeneration of transformed tissues

    • Solution: Adjust plant growth regulators in regeneration media; optimize environmental conditions (temperature, light, humidity)

What controls should be included when studying cemA function to ensure reliable results?

Robust experimental design for cemA studies should include:

  • Genetic controls:

    • Wild-type plants/tissues as negative controls

    • Known chloroplast mutants (e.g., rcm1) as positive controls for chloroplast development phenotypes

    • Empty vector controls for transformation experiments

  • Expression controls:

    • Housekeeping genes (e.g., actin, ubiquitin) for normalizing expression data

    • Other chloroplast genes with known expression patterns for comparative analysis

  • Technical controls:

    • No-template controls for PCR/RT-PCR

    • Mock transformations to control for tissue culture effects

    • Immunoprecipitation with non-specific antibodies for interaction studies

  • Environmental controls:

    • Standardized growth conditions (temperature, light, humidity) to minimize environmental variables

    • Multiple biological replicates grown at different times to account for seasonal variations

    • Internal controls for all biochemical assays

How should I analyze and interpret changes in cemA expression across different experimental conditions?

For robust analysis of cemA expression:

  • Normalization approaches:

    • For RT-qPCR: Use multiple reference genes stable under your experimental conditions

    • For protein quantification: Normalize to total protein content and use loading controls

    • For transcriptomic data: Apply appropriate normalization methods (RPKM, TPM, or specialized methods for RNA-Seq data)

  • Statistical analysis:

    • Perform appropriate statistical tests (t-test, ANOVA) based on experimental design

    • Conduct power analysis to ensure sufficient sample size

    • Consider corrections for multiple testing when analyzing many genes simultaneously

  • Visualization methods:

    • Heat maps for comparing expression across multiple conditions

    • Line graphs to show expression changes over developmental time points

    • Box plots to display variability between biological replicates

  • Integration with other data types:

    • Correlate expression changes with phenotypic observations

    • Integrate with protein abundance data to assess post-transcriptional regulation

    • Compare with expression patterns of other chloroplast genes to identify co-regulated modules

What bioinformatic tools and resources are most useful for studying cemA sequence and functional conservation?

Key bioinformatic resources include:

  • Sequence databases and analysis tools:

    • NCBI GenBank for sequence retrieval

    • Sol Genomics Network (SGN) for tomato-specific information

    • UniProt for protein annotation

    • Tomato Expression Database (TED) for expression data

  • Multiple sequence alignment tools:

    • MUSCLE or Clustal Omega for comparing cemA sequences across species

    • JalView for visualization and analysis of alignments

  • Structural prediction resources:

    • TMHMM or TOPCONS for transmembrane domain prediction

    • AlphaFold for 3D structure prediction

    • PyMOL or UCSF Chimera for structure visualization

  • Functional annotation and pathway resources:

    • Gene Ontology (GO) for functional annotation

    • KEGG for pathway mapping

    • SolCyc for tomato-specific metabolic pathways

  • Comparative genomics platforms:

    • Ensembl Plants for genomic context

    • GreenPhylDB for plant phylogenetic relationships

    • PLAZA for comparative genomics across plant species

How can I distinguish between direct and indirect effects when manipulating cemA expression?

Differentiating direct from indirect effects requires:

  • Time-course experiments:

    • Track changes immediately following cemA manipulation

    • Direct effects typically occur before indirect/downstream effects

    • Use inducible expression systems for temporal control

  • Dose-response relationships:

    • Test varying levels of cemA expression

    • Direct effects often show proportional responses to expression levels

    • Indirect effects may show threshold-dependent responses

  • Biochemical validation:

    • Use in vitro assays with purified components to confirm direct interactions

    • Reconstitute minimal systems to test sufficiency for observed effects

  • Genetic approaches:

    • Use complementation studies with modified versions of cemA

    • Create specific mutations that affect different functions

    • Perform epistasis analysis with genes in potential regulatory pathways

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Construct network models to distinguish primary from secondary effects

    • Use computational approaches to infer causal relationships

What are promising areas for future research involving cemA in tomato?

Several emerging research directions show promise:

  • Synthetic biology applications:

    • Engineering optimized versions of cemA for enhanced photosynthetic efficiency

    • Creating synthetic chloroplast membrane systems with modified cemA proteins

    • Developing biomimetic membranes that incorporate cemA functionality

  • Climate adaptation strategies:

    • Investigating cemA's role in chloroplast responses to temperature extremes

    • Developing cemA variants that confer improved stress tolerance

    • Studying cemA function under predicted future climate conditions

  • Comparative studies across Solanaceae:

    • Analyzing cemA evolution and functional divergence across related species

    • Identifying natural variants with enhanced properties for crop improvement

    • Exploring how cemA function varies in wild relatives adapted to extreme environments

  • Integration with emerging technologies:

    • Using single-cell RNA-seq to study cell-specific cemA expression patterns

    • Applying CRISPR base editing for precise cemA modifications

    • Utilizing advanced imaging techniques to visualize cemA dynamics in vivo

How might cemA studies contribute to broader understanding of chloroplast biology and plant adaptation?

CemA research can advance several fundamental areas:

  • Chloroplast membrane organization:

    • Understanding how membrane proteins like cemA organize within the chloroplast envelope

    • Elucidating the dynamic nature of chloroplast membranes during development and stress

    • Characterizing protein complexes that include cemA and their structural arrangements

  • Evolutionary insights:

    • Exploring how cemA function has evolved across plant lineages

    • Identifying selective pressures on chloroplast membrane proteins

    • Understanding the coordination between nuclear and chloroplast genomes in evolution

  • Developmental transitions:

    • Clarifying cemA's role in chloroplast-to-chromoplast transitions during fruit ripening

    • Understanding how cemA function changes during leaf senescence

    • Investigating potential roles in signaling between organelles during development

  • Climate adaptation mechanisms:

    • Exploring how cemA may contribute to photosynthetic adaptations to changing environments

    • Investigating natural variation in cemA function across tomato varieties adapted to different climates

    • Identifying potential targets for engineering improved climate resilience

What interdisciplinary approaches could enhance cemA research in tomatoes?

Integrating multiple disciplines could accelerate cemA research:

  • Computational biology and machine learning:

    • Predicting cemA function and interactions using deep learning approaches

    • Modeling chloroplast membrane dynamics with cemA components

    • Using network biology to place cemA in broader cellular contexts

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize cemA organization in native membranes

    • Cryo-electron microscopy for structural characterization of cemA-containing complexes

    • Live cell imaging to track cemA dynamics during developmental transitions

  • Systems biology approaches:

    • Multi-omics integration to understand cemA in the context of global cell responses

    • Flux analysis to quantify cemA's impact on photosynthetic and metabolic outputs

    • Genome-scale modeling to predict consequences of cemA modifications

  • Synthetic biology and bioengineering:

    • Designing minimal chloroplast systems with defined cemA components

    • Engineering novel functions into cemA proteins

    • Creating biosensors based on cemA properties for monitoring chloroplast conditions

  • Field-based phenomics:

    • High-throughput phenotyping of cemA variants under field conditions

    • Correlating cemA sequence variation with adaptive traits across diverse environments

    • Validating laboratory findings in agricultural settings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.