Recombinant Solanum lycopersicum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
petD
Target Protein Sequence
MGITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of petD in the cytochrome b6/f complex?

PetD is an essential component of the cytochrome b6/f complex that forms a mildly protease-resistant subcomplex with cytochrome b6. This subcomplex serves as a template for the assembly of Cyt f and PetG, ultimately producing a protease-resistant cytochrome moiety. The PetC and PetL proteins then participate in the assembly of the functional dimer . PetD is particularly important because its absence affects the stability of other components - PetD becomes more unstable in the absence of Cyt b6, and the synthesis of Cyt f is greatly reduced when either Cyt b6 or PetD is inactivated, indicating that both proteins are prerequisites for the proper synthesis of Cyt f .

Methodologically, researchers investigating this role should employ Blue Native (BN)-PAGE analysis combined with immunoblotting using specific antibodies against the complex components to assess complex assembly. This approach allows visualization of different forms of the complex (dimer, monomer, and intermediates) and their relative abundance, providing insights into assembly dynamics.

How is the secondary structure of Solanum lycopersicum petD characterized?

The secondary structure of proteins like petD can be characterized using multiple complementary approaches. Based on recombinant protein analysis methods similar to those used for other proteins, such as Rrd1, prediction tools like SWISS MODEL and Phyre2 can be used to model the structure based on sequence alignments made by HMM-HMM matching . For petD specifically, researchers would start with the known template structures of cytochrome b6/f complex components.

Experimentally, circular dichroism spectroscopy can be employed to determine the proportions of α-helices and β-sheets. Fluorescence spectroscopy is valuable for assessing whether the recombinant protein exhibits properly folded tertiary structure under physiological conditions . For a more detailed structural analysis, X-ray crystallography or cryo-electron microscopy would be preferred, though these techniques require highly pure and stable protein preparations.

What conservation patterns are observed in petD across different plant species?

Conservation analysis of proteins like petD typically reveals evolutionary importance of specific regions. Using approaches similar to those for other proteins, tools like the PDBsum server can be employed to generate sequence colored by residue conservation . When analyzing conservation patterns for petD, researchers should focus on:

  • Identifying highly conserved (red) versus poorly conserved (blue) regions

  • Correlating conservation with functional domains

  • Examining conservation patterns in relation to interaction surfaces with other subunits

This type of analysis helps identify critical functional regions that have been maintained through evolutionary pressure, suggesting their importance for protein function, complex assembly, or stability. For PetD, the regions interacting with cytochrome b6 would likely show high conservation due to their essential role in complex formation.

What expression system is optimal for producing recombinant Solanum lycopersicum petD?

The optimal expression system for recombinant petD from Solanum lycopersicum is likely Escherichia coli, which offers rapid growth, high protein yields, and well-established protocols. Based on successful approaches with similar proteins, the pET-21d (+) vector system (Novagen) has proven effective for recombinant protein expression and purification . This system provides high-level expression under the control of strong bacteriophage T7 transcription.

For petD expression, the methodological approach should include:

  • PCR amplification of the petD gene from Solanum lycopersicum cDNA using gene-specific primers with appropriate restriction sites (such as NheI and XhoI)

  • Cloning the amplified gene into pET-21d (+) vector

  • Transformation into a suitable E. coli expression strain like BL21(DE3)

  • Induction of protein expression with IPTG, with optimization of temperature, concentration, and duration

Expression conditions typically require optimization, as shown in the table below:

ParameterTested RangeOptimal Condition
IPTG Concentration0.1-1.0 mM0.5 mM
Post-induction Temperature16-37°C25°C
Induction Duration3-24 hours16 hours
OD600 at Induction0.4-1.00.6-0.8

Verification of successful expression should be performed by SDS-PAGE and Western blot analysis using a suitable antibody, such as anti-His tag antibody if a His-tag was incorporated into the construct .

What purification strategy yields the highest purity and activity for recombinant petD?

For obtaining high-purity recombinant petD protein with preserved activity, a multi-step purification strategy is recommended. Based on approaches used for similar proteins:

  • Initial Capture: If expressing with a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides effective initial purification

  • Intermediate Purification: Ion exchange chromatography based on the theoretical pI of petD

  • Polishing Step: Size exclusion chromatography to remove aggregates and achieve high purity

Each step should be optimized for buffer composition, pH, salt concentration, and elution conditions. For petD specifically, maintaining mild conditions is crucial to preserve the native conformation and activity.

The purification should be monitored by SDS-PAGE and Western blot, with antibodies specific to petD or to the fusion tag . Functional assays should be performed at each step to track protein activity and ensure the purification process preserves the native conformation. Final purity should exceed 95% for most biophysical and structural characterization techniques.

How can researchers verify the correct folding of recombinant petD?

Verifying correct protein folding is critical for functional studies. For petD, a combination of techniques should be employed:

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence spectra can reveal properly folded tertiary structures under physiological conditions . The emission maximum around 330-340 nm typically indicates buried tryptophans in a properly folded structure.

  • Circular Dichroism (CD): Far-UV CD spectroscopy (190-260 nm) can confirm secondary structure content, while near-UV CD (260-320 nm) can provide information about tertiary structure.

  • Limited Proteolysis: Correctly folded proteins typically show resistance to mild proteolytic digestion compared to misfolded variants.

  • Functional Assays: The ability of purified petD to interact with known binding partners, particularly cytochrome b6, can be assessed using co-immunoprecipitation or surface plasmon resonance.

  • Thermal Shift Assays: These can provide information about protein stability and proper folding by monitoring the protein's melting temperature.

For petD specifically, assessing its ability to form the expected subcomplex with cytochrome b6 would be a strong indication of proper folding and biological activity.

How can the interaction between petD and other components of the cytochrome b6/f complex be analyzed?

Multiple complementary techniques can be employed to analyze interactions between petD and other components of the cytochrome b6/f complex:

  • Blue Native-PAGE followed by immunoblotting with antibodies against Cyt b6, PetD, and Cyt f can reveal the assembly state of the complex and subcomplex formation . This approach allows visualization of dimers, monomers, and intermediate assembly states.

  • Co-immunoprecipitation (Co-IP): Using antibodies against petD to pull down interacting partners, followed by Western blot or mass spectrometry analysis of the co-precipitated proteins.

  • Pulse-chase labeling: This technique can reveal the dynamics of complex assembly by monitoring newly synthesized proteins. As demonstrated in studies of the dac mutant, pulse labeling with [35S]methionine followed by immunoprecipitation with specific antibodies can show differential rates of synthesis and assembly of complex components .

  • Yeast two-hybrid or split-GFP assays: These can be used to confirm direct protein-protein interactions between petD and specific binding partners.

  • Surface plasmon resonance or isothermal titration calorimetry: These techniques provide quantitative binding parameters (affinity, kinetics) for purified components.

The most comprehensive approach combines in vivo (BN-PAGE, Co-IP) and in vitro (biophysical) methods to build a complete picture of interaction dynamics.

What techniques are most effective for studying the stability of the petD protein in different conditions?

To study petD protein stability under different conditions, researchers should employ several complementary approaches:

  • Lincomycin Chase Assays: Treatment with lincomycin, an inhibitor of chloroplast protein synthesis, followed by sampling at regular intervals (e.g., every 2 hours for up to 8 hours) and immunoblotting for petD can reveal the degradation rate of the assembled protein . This approach has shown that assembled cytochrome b6/f complex components are relatively stable once incorporated into the complex.

  • Pulse-Chase Experiments: Labeling with [35S]methionine for a short period followed by addition of excess unlabeled methionine can track the fate of newly synthesized petD, revealing its half-life before assembly into the complex .

  • Thermal Shift Assays: Using fluorescent dyes that bind to hydrophobic regions exposed upon protein unfolding to monitor the melting temperature under various conditions (pH, salt concentration, redox state).

  • Chemical Denaturation: Titration with increasing concentrations of denaturants (urea, guanidinium chloride) while monitoring structural changes with spectroscopic techniques.

For petD specifically, comparing stability in wild-type versus mutant backgrounds (like the dac mutant) can provide insights into factors affecting its stability in vivo .

How can researchers quantitatively assess the integration of petD into functional cytochrome b6/f complexes?

Quantitative assessment of petD integration into functional complexes requires methods that can distinguish between free petD and complex-integrated petD:

  • Blue Native-PAGE combined with quantitative Western blotting: This allows visualization and quantification of different forms of the complex (dimer, monomer, and assembly intermediates) . The ratio between these forms can provide insights into assembly efficiency.

  • Sucrose Gradient Ultracentrifugation: This technique separates protein complexes based on size, allowing quantification of petD in different fractions corresponding to free protein, subcomplexes, and fully assembled complexes.

  • Activity Assays: Measuring electron transport rates or specific activities of the cytochrome b6/f complex can provide functional correlation with assembly efficiency.

  • Ribosome Loading Analysis: Examining the association of petD mRNA with polysomes can reveal translational efficiency, which may correlate with assembly rates .

  • Quantitative Mass Spectrometry: Techniques like SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tags) labeling can provide precise quantification of petD relative to other complex components.

The most robust approach combines structural analysis (BN-PAGE) with functional assessment (activity assays) to connect assembly state with physiological relevance.

How does light intensity affect petD expression and stability in Solanum lycopersicum?

Light intensity significantly impacts photosynthetic protein expression and stability, including components of the cytochrome b6/f complex like petD. Research on Solanum lycopersicum has shown that light conditions modulate several cellular processes:

  • High Light Stress Response: High light intensity can lead to photooxidative stress and bursts of reactive oxygen species (ROS) , which may affect petD stability. Under high light and high-temperature stress, tomato plants upregulate protective molecules like alpha-tocopherol and plastoquinone/plastoquinol to protect photosystem II (PSII) .

  • Light Quality Effects: Specific light wavelengths can induce accumulation of specialized metabolites , suggesting light quality might also influence petD expression through photoreceptor-mediated signaling pathways.

  • Transcriptional Regulation: Light-responsive transcription factors like SlHY5 (ELONGATED HYPOCOTYL 5) and SlPIF3 (PHYTOCHROME INTERACTING FACTOR3) directly bind to promoter elements to activate gene expression . Similar mechanisms might regulate petD expression, though direct evidence specifically for petD would need to be investigated.

For methodological approaches, researchers should design experiments comparing different light intensities (50, 200, 500, 1000 μmol photons m⁻² s⁻¹) and qualities (blue, red, far-red), measuring petD transcript levels via qRT-PCR, protein levels via immunoblotting, and complex assembly via BN-PAGE.

What methods are available for studying the impact of mutations in the petD gene on cytochrome b6/f complex assembly?

Several methodological approaches can be employed to study the impact of mutations in the petD gene:

  • CRISPR-Cas9 Gene Editing: This technique allows precise introduction of mutations into the petD gene in Solanum lycopersicum. Similar approaches have been successfully used for other tomato genes .

  • Virus-Induced Gene Silencing (VIGS): This approach can rapidly downregulate petD expression to create a knockdown phenotype. VIGS has been effectively applied in tomato for functional gene studies, including those related to lycopene biosynthesis and ethylene signaling .

  • Transient Expression of Mutant Variants: Wild-type and mutant petD variants can be transiently expressed in leaf tissue to assess their incorporation into existing complexes.

  • Analysis of Assembly States:

    • Blue Native-PAGE followed by immunoblotting can reveal changes in complex assembly, showing altered ratios of dimer, monomer, and assembly intermediates .

    • Pulse-chase labeling with [35S]methionine can track the fate of newly synthesized mutant proteins compared to wild-type .

  • Electron Transport Measurements: Spectroscopic techniques can assess the functional consequences of mutations on electron flow through the complex.

Understanding the impact of specific mutations requires correlating structural changes with functional outcomes, ideally combining in vivo studies with in vitro analysis of purified recombinant proteins.

How does the assembly of the cytochrome b6/f complex differ between Solanum lycopersicum and other model plant species?

Comparative analysis of cytochrome b6/f complex assembly across plant species reveals both conserved and species-specific aspects of this process. Methodologically, this comparison requires:

  • Phylogenetic Analysis: Comparison of petD sequences across species to identify conserved regions versus variable domains. Similar to the approach used for other proteins , this would reveal evolutionary conservation patterns specific to petD.

  • Blue Native-PAGE Comparison: Similar complex assembly patterns would be expected in closely related species, while differences might emerge in more distant relatives.

  • Protein Interaction Network Analysis: Yeast two-hybrid or co-immunoprecipitation studies in different species can reveal species-specific interaction partners that might influence assembly.

  • Expression Pattern Comparison: Examining light, developmental, and stress responses of petD expression across species using transcriptomics and proteomics.

  • Cross-Species Complementation: Introducing Solanum lycopersicum petD into mutants of other species (such as Arabidopsis) to assess functional conservation.

For Solanum lycopersicum specifically, its sympodial growth pattern and distinct inflorescence structure might suggest unique aspects of photosynthetic regulation, potentially influencing cytochrome b6/f complex assembly in ways different from model species like Arabidopsis.

What are the most common issues in recombinant expression of petD and how can they be resolved?

Recombinant expression of membrane and membrane-associated proteins like petD often encounters specific challenges. Common issues and their solutions include:

  • Poor Solubility/Inclusion Body Formation:

    • Solution: Lower expression temperature (16-20°C), reduce inducer concentration, use solubility-enhancing fusion tags (SUMO, MBP), or employ specialized E. coli strains designed for membrane proteins.

    • For petD specifically, expression as a fusion with MBP (maltose-binding protein) may improve solubility.

  • Improper Folding:

    • Solution: Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ), add specific cofactors to the growth medium, or include stabilizing agents in the buffer.

    • For petD, consider adding specific lipids that might stabilize its native conformation.

  • Low Expression Levels:

    • Solution: Optimize codon usage for E. coli, use stronger promoters, or increase culture volume to compensate.

    • Verify protein expression using Western blot with specific antibodies or against the fusion tag .

  • Proteolytic Degradation:

    • Solution: Include protease inhibitors during purification, use protease-deficient host strains, or optimize buffer conditions.

    • Monitor protein integrity throughout the purification process using SDS-PAGE and Western blotting .

  • Difficulty in Complex Formation:

    • Solution: Co-express petD with its natural binding partners, particularly cytochrome b6, to promote proper folding and complex formation.

How can researchers differentiate between assembly defects and stability issues when studying petD mutants?

Distinguishing between assembly defects and stability issues requires a systematic approach combining multiple techniques:

  • Pulse-Chase Analysis: This can reveal whether the problem occurs during or after assembly.

    • Short pulse labeling (10 minutes) with [35S]methionine followed by immunoprecipitation can reveal initial synthesis rates

    • Extended chase periods can show degradation patterns of newly synthesized proteins

    • If mutant petD shows normal synthesis but rapid disappearance during chase, this suggests a stability issue

  • Lincomycin Treatment: Adding this inhibitor of chloroplast protein synthesis allows monitoring of existing protein stability.

    • If assembled complexes containing mutant petD degrade faster than wild-type after lincomycin addition, this indicates a stability issue

    • If complex levels are low but stable after lincomycin treatment, this suggests an assembly defect

  • Blue Native-PAGE Analysis:

    • Assembly defects typically show accumulation of subcomplexes or intermediates

    • Changes in the ratio between dimers, monomers, and intermediates can differentiate assembly from stability issues

  • Ribosome Loading Analysis:

    • This examines whether mutant petD mRNA associates properly with ribosomes

    • Altered polysome profiles suggest translational regulation issues rather than assembly or stability problems

Through combining these approaches, researchers can pinpoint whether a mutation primarily affects the assembly process or the stability of already assembled complexes.

What strategies can optimize the detection of low-abundance petD protein in plant tissues?

Detecting low-abundance proteins like petD, especially in plant tissues with high levels of interfering compounds, requires optimized methods:

  • Sample Preparation Enhancement:

    • Use specialized protein extraction buffers containing high concentrations of SDS (2-3%)

    • Include reducing agents (DTT or β-mercaptoethanol), protease inhibitors, and PVP to remove phenolic compounds

    • Perform TCA/acetone precipitation to concentrate proteins and remove interfering substances

  • Western Blot Optimization:

    • Use high-sensitivity detection systems like ECL Prime or femto-level chemiluminescent substrates

    • Employ signal amplification systems such as biotin-streptavidin

    • Optimize antibody concentrations and incubation conditions (consider 1:1000 dilution of primary antibody and overnight incubation at 4°C)

    • Use PVDF membranes which typically offer better protein retention than nitrocellulose

  • Specialized Techniques:

    • Employ immunoprecipitation to concentrate petD before detection

    • Consider targeted proteomics approaches like Selected Reaction Monitoring (SRM) for highly specific detection

    • Use fluorescently labeled secondary antibodies and quantitative fluorescence imaging for better linearity and lower background

  • Enhanced Visualization Techniques:

    • Extended exposure times for chemiluminescent detection

    • Signal accumulation using CCD camera systems rather than film

    • Digital image enhancement while maintaining data integrity

By combining these approaches, researchers can significantly improve detection limits for low-abundance proteins like petD in complex plant tissue samples.

How can structural biology approaches advance our understanding of petD function in the cytochrome b6/f complex?

Advanced structural biology approaches can significantly deepen our understanding of petD's role within the cytochrome b6/f complex:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structures (2-3Å) of the entire cytochrome b6/f complex with petD in different functional states

    • Visualization of conformational changes during electron transport

    • Sample preparation would involve purification of intact complexes from Solanum lycopersicum thylakoids

  • X-ray Crystallography:

    • Atomic-resolution structures of recombinant petD alone or in complex with binding partners

    • Co-crystallization with small molecule inhibitors or activators to understand functional mechanisms

    • Requires large amounts of highly pure, homogeneous protein

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein dynamics and solvent accessibility changes during complex assembly

    • Identifies regions of petD involved in protein-protein interactions

    • Reveals conformational changes induced by different physiological conditions

  • Integrative Structural Biology:

    • Combining cryo-EM, crystallography, NMR, and computational modeling

    • Creating dynamic models of complex assembly and function

    • Correlating structure with functional data from mutational studies

These approaches would build upon existing structural predictions, which suggest petD contains eight to nine alpha helices , by providing experimental validation and higher-resolution details of its interactions within the complex.

What role might petD play in stress responses in Solanum lycopersicum?

The cytochrome b6/f complex represents a critical juncture in photosynthetic electron transport, and petD likely plays important roles in stress adaptation in Solanum lycopersicum:

  • Salt Stress Adaptation:

    • Tomato has evolved mechanisms to alleviate Na+ toxicity , which may involve regulation of photosynthetic complexes

    • Research methodology should compare petD expression and complex assembly under control versus salt stress conditions (e.g., 100-200 mM NaCl treatment)

    • Analysis of petD interaction with stress-responsive proteins like SlSOS1 and SlSOS2 using co-immunoprecipitation and yeast two-hybrid assays

  • Light Stress Responses:

    • High light induces photooxidative stress and ROS bursts , requiring photosynthetic adjustments

    • Experimental approaches should include measuring petD abundance and complex assembly under different light intensities

    • Correlation of complex stoichiometry with protective mechanisms like anthocyanin accumulation

  • Integration with Redox Signaling:

    • Reactive oxygen species (ROS) regulate growth, development, and stress responses

    • Research should investigate how H2O2 and other ROS modify petD and affect complex assembly

    • The relationship between redox-regulated phase separation and petD function could be examined

  • Temperature Stress:

    • Combining high temperature with high light stress affects protective molecules like alpha-tocopherol

    • Methodology should include temperature gradient experiments combined with proteomic analysis of cytochrome b6/f complex components

Understanding these relationships would provide insights into how fundamental photosynthetic machinery adapts to environmental challenges, with potential applications for improving crop resilience.

How might genetic modifications of petD improve photosynthetic efficiency in crop plants?

Strategic genetic modifications of petD could potentially enhance photosynthetic efficiency in crop plants:

  • Targeted Amino Acid Substitutions:

    • Identify conserved versus variable residues using evolutionary analysis

    • Design mutations that might optimize electron transfer rates or stability

    • Test variants using both in vitro reconstitution and transgenic plants

    • Measure photosynthetic parameters including electron transport rates, quantum yield, and CO2 fixation

  • Expression Level Optimization:

    • Adjust petD expression to optimize cytochrome b6/f complex stoichiometry

    • Use tissue-specific or condition-responsive promoters to fine-tune expression

    • Employ CRISPR-Cas9 for precise genome editing to modify native regulatory elements

  • Stress-Responsive Modifications:

    • Engineer petD variants with enhanced stability under stress conditions

    • Create fusions with stress-protective domains

    • Incorporate sensors that allow dynamic adjustment of complex assembly under changing conditions

  • Cross-Species Optimizations:

    • Identify naturally optimized petD variants from extremophile plants

    • Create chimeric proteins combining optimal domains from different species

    • Test these variants in model systems before deployment in crops

Potential outcomes and measurements should include:

Modification ApproachExpected BenefitMeasurement Methods
Stability EnhancementImproved performance under stressElectron transport measurements under heat/light stress
Electron Transfer OptimizationHigher quantum efficiencyP700 reduction kinetics, CO2 fixation rates
Expression Level AdjustmentBalanced electron flowGrowth rates, biomass accumulation
Regulatory Element ModificationContext-specific optimizationField trials under varying conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.