Recombinant Solanum lycopersicum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section. We will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a key component of the cytochrome b6-f complex. This complex plays a vital role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Cytochrome b6 in the thylakoid membrane complex?

Cytochrome b6 (encoded by the petB gene) functions as one of the four major subunits of the cytochrome b6/f complex in the photosynthetic electron transport chain. This complex is crucial for catalyzing the oxidation of quinols and the reduction of plastocyanin, thereby establishing the proton force required for ATP synthesis. The complex consists of four major subunits: petA (cytochrome f), petB (cytochrome b6 containing three hemes), petD (subunit IV), and petC (Rieske/Iron/sulfur protein) .

Structurally, cytochrome b6 is a b-type/c-type cytochrome containing three heme groups that are essential for its electron transfer function. The protein is approximately 24 kDa in size and is embedded within the thylakoid membrane, where it participates in the electron transport between photosystem II and photosystem I .

How does PetB gene organization differ between Solanum lycopersicum and other photosynthetic organisms?

While the search results don't provide specific information about the genomic organization of petB in Solanum lycopersicum, studies on cytochrome b6/f complex organization in various species indicate significant conservation across photosynthetic organisms. The gene structure and organization appear to be similar among higher plants, green algae, and cyanobacteria, reflecting the evolutionary importance of this protein complex .

In Chlamydomonas, Oenothera, and tobacco, mutations in the petB gene have revealed its critical role in the assembly of the cytochrome b6/f complex. Though species-specific differences exist, the functional domains and key heme-binding regions of PetB show remarkable conservation across photosynthetic organisms, facilitating comparative studies .

What techniques are used to characterize native PetB protein in Solanum lycopersicum?

Several techniques are employed to characterize native PetB:

  • Immunological detection: Antibodies specific to PetB, such as the AS18 4169 polyclonal antibody, allow for detection and quantification of the protein in plant samples. These antibodies can be used in Western blotting with recommended dilutions of 1:1000 to 1:5000 .

  • Blue native PAGE (BN-PAGE): This technique allows for the isolation and analysis of the intact cytochrome b6/f complex, preserving the native interactions between PetB and other subunits .

  • Spectroscopic analysis: Due to its heme content, cytochrome b6 exhibits characteristic absorption spectra that can be analyzed to determine protein integrity and functional state.

  • Genetic analysis: Studies in various species have used gene knockout/mutation approaches to understand the role of petB in complex assembly and function .

What expression systems are most effective for producing recombinant Solanum lycopersicum Cytochrome b6?

For recombinant expression of membrane proteins like Cytochrome b6, Escherichia coli remains the most widely used system, particularly with pET expression vectors. These vectors utilize the strong T7 promoter system for high-level expression in E. coli strains containing the λDE3 lysogen .

For optimal expression:

  • Vector selection: pET28a is one of the most popular expression plasmids (used in over 40,000 published articles) and contains the T7 promoter adjacent to a lac operator sequence that helps suppress uninduced expression .

  • Improved vector designs: Recent research has identified design flaws in the traditional pET vectors. Implementing improved designs in pET28a has demonstrated increases in protein production that would benefit expression of challenging membrane proteins like Cytochrome b6 .

  • Expression strain selection: E. coli BL21(DE3) and its derivatives are commonly used, with specialized strains available for membrane proteins that may contain additional chaperones or modified membrane compositions.

What strategies can optimize heme incorporation during recombinant expression of PetB?

Ensuring proper heme incorporation is critical for producing functional Cytochrome b6. Based on research with heme-binding proteins from Solanum lycopersicum:

  • Co-expression with heme biosynthesis enzymes: Supplementing the expression host with genes encoding key enzymes in the heme biosynthetic pathway.

  • Heme supplementation: Adding δ-aminolevulinic acid (a heme precursor) or hemin to the growth medium during expression.

  • Verification of heme binding: Similar to the methods used for SlHBP2 (another heme-binding protein from tomato), recombinant PetB can be tested for heme-binding by incubating purified protein with hemin-agarose followed by SDS-PAGE analysis of bound fractions .

  • Lowered expression temperature: Using reduced temperatures (16-20°C) during induction to slow protein synthesis and allow time for proper heme incorporation.

How do mutations in the Cytochrome b6 sequence affect protein stability and complex assembly?

Mutations in PetB significantly impact the assembly and stability of the entire cytochrome b6/f complex:

  • Complex assembly: Studies in Chlamydomonas and other organisms have shown that mutations in petB lead to significantly reduced levels of all subunits in the complex. This could result from two mechanisms:

    • Faster degradation of improperly assembled proteins

    • Disruption of the hierarchical organization of expression (controlled epistasy of synthesis or CES process)

  • Stability effects: Despite being one of the major subunits, mutations in petB affect the accumulation of other components. In mutants lacking low-molecular-weight subunits like PetG and PetN, the major subunits including Cytochrome b6 are only faintly detectable, demonstrating the interdependence of complex components .

  • Functional domains: The three heme-binding regions are particularly sensitive to mutations, with substitutions potentially affecting electron transport capacity, redox potential, or protein-protein interactions within the complex.

What purification protocols yield the highest purity and activity for recombinant Solanum lycopersicum Cytochrome b6?

Effective purification strategies for recombinant Cytochrome b6:

  • Affinity chromatography: Expression with an N-terminal His6-tag (as in pET28a) allows for initial purification using immobilized metal affinity chromatography (IMAC). The pET28a vector includes a thrombin protease recognition site that enables tag removal after purification .

  • Membrane protein considerations: As an integral membrane protein, PetB requires detergent solubilization. Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin help maintain protein structure and function.

  • Size exclusion chromatography: A polishing step to separate monomeric protein from aggregates and remove remaining impurities.

  • Functional verification: Spectroscopic analysis to confirm proper heme incorporation and protein folding.

Purification StageMethodBuffer ComponentsExpected Purity
Crude extractionMembrane isolation50 mM Tris-HCl pH 8.0, 200 mM NaCl5-10%
SolubilizationDetergent treatmentAbove + 1% DDM15-20%
IMACNi-NTA chromatographyAbove + 0.05% DDM + imidazole gradient70-80%
Size exclusionSuperdex 20020 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% DDM>95%

What spectroscopic methods are most informative for analyzing the functional state of recombinant Cytochrome b6?

Several spectroscopic techniques provide valuable information on Cytochrome b6 structure and function:

  • UV-Visible Absorption Spectroscopy: The heme groups in Cytochrome b6 exhibit characteristic absorption bands that shift upon reduction/oxidation. This allows assessment of:

    • Proper heme incorporation

    • Redox state of the protein

    • Functional integrity

  • Circular Dichroism (CD): Provides information about secondary structure elements and protein folding.

  • Electron Paramagnetic Resonance (EPR): Highly informative for examining the electronic structure of the heme centers in different redox states.

  • Resonance Raman Spectroscopy: Can provide detailed information about the heme environment and coordination state.

  • Fluorescence Spectroscopy: When combined with site-directed fluorescent labeling, can reveal conformational changes during electron transfer.

How can researchers verify proper integration of recombinant PetB into functional complexes?

Verifying proper integration of recombinant PetB into functional complexes involves several approaches:

  • Blue Native PAGE (BN-PAGE): This technique preserves protein-protein interactions and can be used to isolate and analyze intact cytochrome b6/f complexes .

  • Co-immunoprecipitation: Using antibodies against other complex components to pull down assembled complexes containing recombinant PetB.

  • Functional activity assays: Measuring electron transport rates in reconstituted systems or proteoliposomes.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify interaction partners and structural arrangements.

  • Comparison with native complex: Using antibodies like AS18 4169 that recognize the N-terminal region of PetB to compare expression levels and complex formation between recombinant and native systems .

How can recombinant Solanum lycopersicum Cytochrome b6 be used to study drought resistance mechanisms in tomatoes?

Recombinant PetB can serve as a valuable tool for understanding drought resistance mechanisms:

  • Stress response studies: By comparing the expression, modification, and activity of PetB under drought conditions versus normal conditions, researchers can understand how the photosynthetic electron transport chain adapts to water limitation.

  • Interaction with stress-responsive proteins: Identifying protein-protein interactions between PetB and drought-induced factors.

  • Site-directed mutagenesis: Creating mutant versions of PetB that mimic drought-induced modifications to study their functional impacts.

  • In vitro assays: Using purified recombinant PetB to measure electron transport efficiency under conditions that simulate drought stress (altered pH, ion concentrations, etc.).

  • Transgenic applications: Expressing modified versions of PetB in tomato plants to test hypotheses about specific modifications that might confer enhanced drought tolerance.

What insights can comparative analysis of recombinant PetB from different Solanum species provide about evolutionary adaptation?

Comparative analysis of PetB across Solanum species can reveal important evolutionary insights:

  • Sequence conservation analysis: Identifying highly conserved regions that are likely essential for function versus variable regions that may represent adaptations to specific ecological niches.

  • Structure-function relationships: Testing whether sequence variations correlate with functional differences in electron transport efficiency, redox potentials, or protein stability.

  • Environmental adaptation signatures: Comparing PetB from Solanum species adapted to different environments (desert, tropical, temperate) to identify potential adaptive modifications.

  • Co-evolution with interacting partners: Analyzing how PetB has co-evolved with other components of the photosynthetic machinery across the Solanum genus.

  • Relationship to genome organization: Studies like those on tomato chromosome 6 can reveal how the genomic context of the petB gene varies across species and whether this correlates with expression patterns or functional adaptations .

How does the heme-binding mechanism of PetB compare with other heme-binding proteins in Solanum lycopersicum?

Comparing PetB with other heme-binding proteins like SlHBP2 reveals interesting parallels and differences:

  • Binding mechanisms: While both bind heme, they likely use different structural motifs. SlHBP2 belongs to the SOUL heme-binding family and relies on two key tryptophan residues (W57 and W211) for heme binding . In contrast, Cytochrome b6 has evolved specialized heme-binding pockets for its three heme groups.

  • Functional roles: Despite both binding heme, these proteins serve vastly different functions. SlHBP2 demonstrates antimicrobial properties against various plant pathogens , while PetB functions in electron transport during photosynthesis.

  • Evolutionary relationships: Comparative analysis can reveal whether these proteins share any common ancestral domains or evolved heme-binding capabilities independently.

  • Heme coordination chemistry: Differences in the heme iron coordination (axial ligands) between PetB and SlHBP2 would reflect their distinct functional requirements.

  • Redox properties: The redox potentials of the heme groups in these proteins likely differ significantly based on their biological roles.

What strategies can resolve issues with low expression yield of recombinant Solanum lycopersicum Cytochrome b6?

When facing low expression yields:

  • Improved vector design: Implementing the improved designs for pET expression plasmids described in recent research can significantly increase protein production. These improvements address design flaws in the original plasmids from the 1980s .

  • Codon optimization: Adapting the Solanum lycopersicum sequence to match E. coli codon usage preferences.

  • Expression conditions optimization: Systematic testing of:

    • Induction temperature (typically lower temperatures for membrane proteins)

    • Inducer concentration

    • Duration of induction

    • Cell density at induction

  • Alternative host strains: Testing specialized E. coli strains designed for membrane protein expression or toxic protein expression.

  • Fusion partners: Adding solubility-enhancing fusion partners that can be later removed via engineered protease sites.

How can researchers address protein misfolding and aggregation during recombinant PetB expression?

To mitigate protein misfolding and aggregation:

  • Chaperone co-expression: Co-expressing molecular chaperones like GroEL/GroES to assist in proper folding.

  • Membrane-mimetic environments: Adding lipids or detergents during cell lysis and purification to provide a suitable environment for the membrane protein.

  • Fusion with membrane-targeting sequences: Including sequences that direct the recombinant protein to the bacterial membrane.

  • Expression temperature: Lowering the expression temperature to 16-20°C to slow protein synthesis and allow time for proper folding.

  • Detergent screening: Systematically testing different detergents for their ability to maintain PetB in a soluble, correctly folded state.

What controls and validation experiments are essential when studying recombinant PetB function?

Essential controls and validation experiments include:

  • Spectroscopic verification: Confirming proper heme incorporation and folding through characteristic absorption spectra.

  • Comparison with native protein: Using antibodies like AS18 4169 to compare expression levels, migration patterns, and complex formation between recombinant and native PetB .

  • Activity assays: Measuring electron transport activity and comparing with native complex activity.

  • Negative controls: Including non-functional mutants (e.g., heme-binding site mutations) to confirm that measured activity is specific to properly folded PetB.

  • Stability assessment: Monitoring protein stability under experimental conditions using techniques like thermal shift assays or limited proteolysis.

  • Complex formation: Verifying interactions with other components of the cytochrome b6/f complex through techniques like co-immunoprecipitation or BN-PAGE .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.