Recombinant Solanum lycopersicum Defender against cell death 1 (DAD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
Target Protein Sequence
MAKSSATKDAQALFHSLRSAYAATPTNLKIIDLYVIFAISTALIQVVYMAIVGSFPFNSF LSGVLSCIGTAVLAVCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
Uniprot No.

Target Background

Function
Defender against cell death 1 (DAD1) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process, known as protein N-glycosylation, is the first step in N-linked glycosylation. N-glycosylation occurs cotranslationally, and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for achieving maximal enzyme activity.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what is its function in Solanum lycopersicum?

DAD1 (Defender Against Cell Death 1) in tomato (Solanum lycopersicum) functions as a phospholipase A(1) with chloroplastic localization. It belongs to a family of lipases that play critical roles in programmed cell death (PCD) processes and lipid metabolism. The protein is encoded by genes such as LOC101256040 in the tomato genome, with the gene product being classified as "phospholipase A(1) DAD1, chloroplastic-like" . DAD1 homologs in tomato, such as LeLID1 (Lipase homologous to DAD1), demonstrate lipase activity with specificity toward triacylglycerols (TAGs) with long acyl chains, suggesting roles in fat mobilization during specific developmental stages .

How does DAD1 expression vary during tomato plant development?

Tomato DAD1 homologs show distinct tissue-specific and developmental expression patterns. For instance, LeLID1 transcript levels increase rapidly during seed germination, reaching maximum expression approximately four days after germination before rapidly decreasing . Expression analysis demonstrates that DAD1-like proteins are primarily found in cotyledons and hypocotyls but show limited expression in roots . Unlike some other cell death-related proteins that are highly expressed during flower or fruit development, tomato DAD1 homologs show little expression in these tissues, suggesting a specialized role in early developmental processes rather than reproductive stages .

What is the enzymatic activity profile of recombinant Solanum lycopersicum DAD1?

Recombinant tomato DAD1 (LeLID1) shows optimal lipase activity at pH 8.0, indicating alkaline conditions for maximum functionality . Substrate specificity studies reveal high activity against triacylglycerols (TAGs) containing long acyl chains, while showing minimal activity toward phosphatidylcholine or monogalactosyldiacylglycerol . Importantly, TAGs composed of short acyl chains cannot serve as substrates for the enzyme, demonstrating clear chain-length specificity . This biochemical profile suggests a specialized role in metabolizing specific lipid substrates during developmental processes such as germination.

How does programmed cell death relate to DAD1 function during abscission in tomato?

Programmed cell death (PCD) has been identified as a key mechanism during the late stages of abscission in tomato, with multiple hallmarks of PCD observed including loss of cell viability, altered nuclear morphology, DNA fragmentation, elevated reactive oxygen species, and increased enzymatic activities . While studies have directly connected the expression of certain ribonucleases (like LX) to this process, the specific role of DAD1 requires further investigation. Research has demonstrated that overexpression of antiapoptotic proteins results in retarded abscission, confirming the requirement of PCD for normal abscission progression . The expression pattern of DAD1 should be analyzed in relation to the observed asymmetric distribution of PCD markers and nuclease gene expression between proximal and distal tissues of the abscission zone to establish its precise function in this process.

What experimental approaches are most effective for studying DAD1 recombinant protein activity?

When designing experiments to study recombinant DAD1 activity, researchers should implement multi-parameter approaches that combine biochemical assays with molecular and cellular techniques. The recombinant protein should be expressed using appropriate vector systems such as pcDNA3.1-C-(k)DYK or customized vectors with consideration for adding C-terminal tags (such as DYKDDDDK) for purification and detection . Enzymatic activity should be assessed across a pH range (with particular attention to alkaline conditions around pH 8.0) and with various lipid substrates including long-chain TAGs, phospholipids, and galactolipids . Subcellular fractionation studies can determine the precise localization of the protein, which appears predominantly in soluble fractions rather than membrane-bound in certain tissues .

How can homeologous recombination techniques be applied to study DAD1 function across Solanum species?

Homeologous recombination approaches offer powerful tools for investigating DAD1 function across different Solanum species. Using introgression lines containing chromosome segments from different Solanum species (such as S. lycopersicoides) in the genetic background of cultivated tomato, researchers can examine how DAD1 variants affect PCD processes . Recombination rates within homeologous segments are typically reduced to 0-10% of expected frequencies, but can be improved by using longer introgressed segments (reaching 40-50% of normal rates) or double-introgression lines containing segments on opposite chromosome arms . To further enhance homeologous recombination when studying DAD1, crossing S. lycopersicoides introgression lines with phylogenetically intermediate species like L. pennellii has proven effective, with highest recombination rates observed in regions where segments overlap .

What are the optimal conditions for expressing recombinant Solanum lycopersicum DAD1 in experimental systems?

For optimal expression of recombinant Solanum lycopersicum DAD1, the full open reading frame (ORF) sequence (typically around 1332bp for DAD1-like genes) should be cloned using seamless cloning technology into expression vectors such as pcDNA3.1+/C-(K)DYK . The inclusion of C-terminal tags facilitates protein purification and detection in downstream applications. For expression systems, both prokaryotic (E. coli) and eukaryotic (insect cells, yeast) systems can be used, though eukaryotic systems may provide better post-translational modifications. Expression should be performed at temperatures between 16-28°C to ensure proper protein folding, with induction parameters optimized through pilot experiments. Purification should employ gentle techniques to maintain the native conformation necessary for lipase activity, and protein functionality should be verified through lipase activity assays using long-chain TAGs as substrates and conducting assays at pH 8.0 .

How should researchers design controlled experiments to study DAD1's role in programmed cell death in tomato?

When designing experiments to study DAD1's role in programmed cell death, researchers should implement a comprehensive approach that includes:

  • Gene expression manipulation:

    • RNAi or CRISPR-Cas9 for DAD1 knockdown/knockout

    • Overexpression using constitutive and tissue-specific promoters

    • Inducible expression systems to control timing of expression

  • Tissue-specific analysis:

    • Focus on abscission zones where asymmetric PCD has been documented

    • Compare cotyledons and hypocotyls (where DAD1 homologs show expression) with roots (minimal expression)

    • Analyze germinating seeds at different time points (days 1-7 after germination)

  • PCD marker detection:

    • Cell viability assays (Evans blue, FDA staining)

    • Nuclear morphology analysis (DAPI staining)

    • DNA fragmentation (TUNEL assay)

    • Reactive oxygen species measurement

    • Enzymatic activity assays for PCD-related enzymes

  • Control treatments:

    • Include antiapoptotic protein expression as a negative control

    • Use known PCD inducers as positive controls

    • Implement appropriate vector-only controls

Environmental conditions should be strictly controlled according to established tomato experimental guidelines to ensure reproducibility .

What analytical techniques are most appropriate for characterizing lipase activity of recombinant DAD1 from tomato?

To properly characterize the lipase activity of recombinant DAD1 from tomato, researchers should employ these analytical techniques:

Analytical MethodApplicationData Output
Spectrophotometric assaysDetermination of lipase activity rateKinetic parameters (Km, Vmax)
pH profilingIdentification of optimal pH conditionsActivity curve with peak at pH 8.0
Substrate specificity analysisTesting various lipid substratesRelative activity percentages
Thin-layer chromatographyVisualization of reaction productsMigration patterns of lipid products
HPLC/Mass spectrometryDetailed analysis of lipid substrates and productsQuantitative composition data
Thermal stability testingDetermination of temperature optimaActivity retention percentages
Inhibitor studiesIdentification of regulatory mechanismsInhibition constants (Ki)

For optimal results, researchers should perform lipase activity assays using various TAG substrates with different acyl chain lengths (C4-C24) to confirm the preference for long-chain TAGs reported in homologous proteins . Activity measurements should be conducted at different pH values (pH 4-10) with particular attention to the alkaline range, and protein stability should be assessed under various buffer and temperature conditions to establish the parameters for maximum enzymatic activity.

How can researchers differentiate between DAD1's direct effects and secondary consequences in programmed cell death pathways?

To differentiate between direct effects of DAD1 and secondary consequences in PCD pathways, researchers should implement time-course experiments combined with molecular and biochemical analyses. Immediately following DAD1 manipulation (overexpression, silencing, or inhibition), researchers should monitor early molecular events (0-6 hours) including lipid profile changes, calcium signaling, and immediate transcriptional responses. These early events likely represent direct consequences of DAD1 activity. Secondary effects can be identified by examining later events (6-48 hours) such as downstream gene expression changes, organelle deterioration, and execution of cell death. Comparative transcriptomics and proteomics at multiple time points can help establish the sequence of events and distinguish primary targets from secondary responses. Additionally, biochemical reconstitution experiments using purified components can confirm direct interactions and effects of DAD1 on potential substrates.

What statistical approaches are most appropriate for analyzing DAD1 expression data across developmental stages?

When analyzing DAD1 expression data across developmental stages, researchers should employ multiple statistical approaches to ensure robust interpretation:

  • For time-course expression data (such as expression during germination ):

    • Repeated measures ANOVA to assess significant changes over time

    • Post-hoc tests (Tukey's HSD or Bonferroni) to identify specific time points with significant differences

    • Regression analysis to model expression patterns (linear, polynomial, or exponential models may be appropriate)

  • For tissue-specific expression comparisons:

    • Two-way ANOVA to evaluate tissue and developmental stage effects and their interactions

    • Principal Component Analysis (PCA) to visualize clustering of samples based on expression profiles

    • Hierarchical clustering to identify tissues with similar expression patterns

  • For correlating expression with phenotypic or biochemical data:

    • Pearson or Spearman correlation coefficients to measure relationships

    • Multiple regression to model relationships between DAD1 expression and multiple dependent variables

    • Path analysis to distinguish direct and indirect effects in complex developmental pathways

Data normalization using appropriate reference genes should be performed prior to statistical analysis, and non-parametric alternatives should be considered when data do not meet assumptions for parametric tests.

What are common challenges in purifying active recombinant DAD1 protein and how can they be addressed?

Researchers frequently encounter several challenges when purifying active recombinant DAD1 protein:

  • Protein aggregation and inclusion body formation:

    • Lower expression temperature to 16-20°C

    • Use solubility-enhancing fusion tags (MBP, SUMO, or GST)

    • Optimize inducer concentration and induction time

    • Consider co-expression with chaperones

  • Low enzymatic activity of purified protein:

    • Ensure pH is maintained near 8.0 during purification steps

    • Include glycerol (10-20%) in purification buffers to stabilize protein

    • Minimize exposure to air/oxidation by including reducing agents

    • Use gentle elution conditions and avoid harsh pH changes

  • Proteolytic degradation:

    • Include protease inhibitor cocktails in all buffers

    • Perform purification steps at 4°C

    • Reduce purification time by optimizing protocols

    • Consider on-column cleavage of fusion tags

  • Low yield from expression systems:

    • Optimize codon usage for expression host

    • Test multiple expression vectors and host strains

    • Scale up culture volumes and optimize media composition

    • Consider baculovirus expression systems for higher yields of functional protein

Activity assays should be performed immediately after purification using long-chain TAGs as substrates, and aliquots should be flash-frozen to preserve activity for long-term storage.

How can researchers address conflicting results when studying DAD1's role in different tissues or developmental stages?

When faced with conflicting results regarding DAD1's role across different tissues or developmental stages, researchers should systematically address potential sources of variation:

  • Methodological inconsistencies:

    • Standardize experimental conditions, including growth parameters, tissue collection, and analytical techniques

    • Verify antibody specificity when using immunological detection methods

    • Ensure proper normalization in expression studies using multiple reference genes

    • Validate key findings using complementary techniques

  • Biological complexity:

    • Consider the existence of multiple DAD1 isoforms or homologs with tissue-specific functions

    • Examine post-translational modifications that might alter protein function in different tissues

    • Investigate tissue-specific interaction partners that could modify DAD1 activity

    • Analyze developmental timing with higher temporal resolution

  • Experimental design improvements:

    • Implement factorial designs to simultaneously evaluate multiple variables

    • Use genetic mosaics or inducible systems for tissue-specific manipulation

    • Perform side-by-side comparisons of tissues under identical conditions

    • Incorporate evolutionary comparisons across related Solanum species to identify conserved functions

  • Data integration:

    • Apply meta-analysis techniques to synthesize results across studies

    • Develop mathematical models to explain tissue-specific differences

    • Use systems biology approaches to place DAD1 in broader cellular networks

    • Consider epigenetic mechanisms that might influence DAD1 expression in different contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.