Recombinant Solanum lycopersicum Ethylene receptor 1 (ETR1)

Shipped with Ice Packs
In Stock

Description

Ethylene Perception and Signal Transduction

ETR1 operates as a negative regulator of ethylene responses:

  1. Ethylene binding inactivates ETR1, derepressing downstream signaling .

  2. Interaction with RTE1/GR: The Golgi-localized RTE1 stabilizes ETR1 in its active (signaling) state, enhancing ethylene insensitivity .

  3. Copper dependence: Ethylene binding requires a copper ion coordinated by residues in the N-terminal domain .

Regulatory Partners

Partner ProteinInteraction SiteFunctional OutcomeSource
RTE1/GRN-terminalStabilizes ETR1’s active state, delaying ripening
CTR1 kinaseC-terminalPhosphorylates ETR1 to propagate signaling
NOP-1 peptideGAF domainInhibits ethylene signaling by blocking receptor output

Mutational Studies

  • L54F/V58I mutations (equivalent to Arabidopsis L39/V43): Reduce ethylene binding by 40–60%, prolonging fruit ripening without abolishing it .

  • Overexpression of etr1-1: Confers dominant ethylene insensitivity, delaying petal senescence and fruit ripening in transgenic tomatoes .

Biophysical Interactions

  • NOP-1 peptide binding: Inhibits ETR1 by occupying the GAF domain, preventing signal transduction .

  • Subcellular localization: ETR1 localizes to the endoplasmic reticulum (ER) and Golgi, with RTE1 facilitating its membrane association .

Fruit Ripening Control

  • Delayed ripening: Overexpression of recombinant etr1-1 under inducible promoters extends shelf life by 5–7 days .

  • Hybrid breeding: etr1 mutants crossed with wild-type lines yield fruits with prolonged ripening and reduced spoilage .

Mechanistic Studies

  • Signal transduction models: Recombinant ETR1 has clarified the roles of histidine kinase activity and RTE1 dependency in ethylene signaling .

  • Peptide inhibitors: NOP-1 and similar peptides offer tools to dissect receptor activation pathways .

Challenges and Future Directions

  • Tissue specificity: ETR1’s effects vary across organs (e.g., stronger in fruits vs. leaves) .

  • Redundancy: Functional overlap with other receptors (e.g., LeETR2, NR) complicates single-gene manipulations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ETR1; Ethylene receptor 1; LeETR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-754
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
ETR1
Target Protein Sequence
MGSLLRMNRLLSSIVESCNCIIDPQLPADDLLMKYQYISDFFIALAYFSIPVELIYFVKK SAVFPYRWVLVQFGAFIVLCGATHLINLWTFNMHTRNVAIVMTTPKALTALVSCITALML VHIIPDLLSVKTRELFLKKKAAQLDREMGIIRTQEETGRHVRMLTHEIRSTLDRHTILKT TLVELGRTLALEECALWMPTRTGLELQLSYTLRHQNPVGLTVPIQLPVINQVFGTNHVVK ISPNSPVARLRPAGKYMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSAR QWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMEQNVALDLARREAEMAVRARND FLAVMNHEMRTPMHAIIALSSLLQETDLTPEQRLMVETILKSSNLLATLINDVLDLSRLE DGSLQLDIGTFNLHALFREVHSLIKPIASVKKLFVTLSLSSDLPEYVIGDEKRLMQILLN VVGNAVKFSKEGNVSISAFVAKSDSLRDPRAPEFFAVPSENHFYLRVQIKDTGIGITPQD IPNLFSKFTQSQALATTNSGGTGLGLAICKRFVNLMEGHIWIESEGLGKGSTAIFIIKLG IPGRANESKLPFVTKLPANHTQMSFQGLKVLVMDENGVSRMVTKGLLTHLGCDVTTVGSR DECLRVVTHEHKVVIMDVSMQGIDCYEVAVVIHERFGKRHGRPLIVALTGNTDRVTKENC MRVGMDGVILKPVSVYKMRSVLSELLEHGVVLES
Uniprot No.

Target Background

Function
ETR1 (Ethylene Receptor 1) may play a crucial role in the early stages of the ethylene signal transduction pathway, potentially acting as an ethylene receptor or a regulator within the pathway.
Database Links
Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Leaves, flowers and fruits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.