Recombinant Solanum lycopersicum Ethylene receptor 2 (ETR2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Solanum lycopersicum Ethylene Receptor 2 (ETR2)

Solanum lycopersicum Ethylene Receptor 2 (ETR2) is an ethylene receptor found in tomatoes (Solanum lycopersicum) . Ethylene receptors are vital in plant biology because they play a crucial role in the perception of ethylene, a gaseous plant hormone that regulates various developmental processes, including fruit ripening, flower development, and senescence .

Recombinant ETR2 refers to the ETR2 protein that has been produced using recombinant DNA technology. This involves isolating the gene encoding ETR2, inserting it into a suitable expression vector, and then introducing this vector into a host organism (e.g., bacteria, yeast, or plant cells) to produce large quantities of the protein . The recombinant protein can then be purified and used for various research purposes, such as studying its biochemical properties, structure, and interactions with other proteins .

Functional Analysis and Research Findings

Research into ETR2 has provided valuable insights into its function and its impact on plant development. Some key findings include:

  • Delayed Floral Transition: Overexpression of ETR2 results in delayed flowering, while mutants with T-DNA insertion in ETR2 show enhanced ethylene sensitivity and early flowering .

  • Starch Accumulation: ETR2 influences starch accumulation in plants. For example, starch granules accumulate in the internodes of ETR2-overexpressing plants .

  • Ethylene Sensitivity: ETR2 reduces ethylene sensitivity in plants. This was observed in transgenic rice plants where ETR2 overexpression led to decreased sensitivity to ethylene .

Role in Ethylene Signaling

Ethylene signaling is a complex process involving multiple components. ETR2 plays a crucial role in this pathway by:

  • Modulating Receptor Conformation: Research suggests that proteins like RTE1 (Reversion-to-Ethylene Sensitivity 1) regulate a conformational switch of ethylene receptors upon ethylene binding, influencing the signal output .

  • Interacting with EIN2: ETR2 interacts with EIN2 (Ethylene Insensitive 2), a key protein in the ethylene signaling pathway. Disrupting the interaction between receptors like ETR2 and EIN2 affects ethylene signaling and impairs plant ethylene responses .

Impact on Agriculture and Horticulture

Understanding the function of ETR2 has significant implications for agriculture and horticulture:

  • Fruit Ripening: Manipulation of ethylene signaling through ETR2 can be used to control fruit ripening. For example, ectopic expression of GR (GREEN-RIPE), a tomato homologue of RTE1, inhibits tomato fruit ripening .

  • Flowering Time: ETR2's role in delaying flowering can be harnessed to manipulate the flowering time of crops, which is crucial for optimizing yield .

Tables of Key Data

PropertyDescriptionReference
Kinase ActivityFunctions as a Ser/Thr kinase and can phosphorylate its receiver domain
Ethylene SensitivityOverexpression reduces ethylene sensitivity
Floral TransitionOverexpression delays floral transition
Starch AccumulationInfluences starch accumulation in internodes
Interaction with EIN2Interacts with EIN2, affecting ethylene signaling

Future Research Directions

Further research on ETR2 could focus on:

  • Structural Analysis: Determining the crystal structure of ETR2 to understand its ethylene-binding mechanism and kinase activity.

  • Protein Interactions: Identifying novel proteins that interact with ETR2 to elucidate the ethylene signaling pathway.

  • Genetic Engineering: Utilizing ETR2 to develop crops with improved fruit ripening, flowering time, and stress tolerance.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
ETR2; Ethylene receptor 2; LeETR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-736
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
ETR2
Target Protein Sequence
MDCNCFDPLLPADELLMKYQYISDFFIAVAYFSIPIELVYFVQKSAVFPYRWVLVQFGAF IVLCGATHLINLWTSTPHTRTVAMVMTTAKFSTAAVSCATAVMLVHIIPDLLSVKTRELF LKNKAAELDREMGLIRTQEETGRYVRMLTHEIRSTLDRHTILKTTLVELGRALQLEECAL WMPTRTGVELQLSYTLHHQNPVGFTVPIQLPVINQVFSANCAVKISPNSAVARLRPTRKY IPGEVVAVRVPLLHLSNFQTNDWPELSPKSYALMVLMLPSNSARQWHVHELELVDVVADQ VAVALSHAAILEESMRARDLLIEQNVALDLARREAETAVRARNDFLGVMNHEMRTPMHAV VALSSLLQESELIPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDVGTFNLHAL FREVLNLIKPVAAVKKLFVTLSLSSDFPEVAIGDEKRLMQILLNVVGNAVKFSKEGSVSV SAVNAKSESLIDPRAPEFFPVQSENHFYLRVQVKDTGSGINPQDFPKLFCKFAQNQEPAT KNSAGTGLGLAICKRFVNLMEGHIWIESEGVGKGSTAIFIVKLGIPGRLNESKLPFTAGL PANHMQMTFQGLKVLVMDDNGFSRMVTKSLLVHLGCDVTTIGSGDECLRILTREHKVLIM DASITGMNCYDVAVSVHEKFGKRLERPLIVALTGNTDQVTKENCLRVGMDGVILKPVSID KMRSVLSGLLEHGTVL
Uniprot No.

Target Background

Function
May function early in the ethylene signal transduction pathway, potentially acting as an ethylene receptor or a pathway regulator.
Database Links
Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Leaves, flowers and fruits.

Q&A

What is the role of ETR2 in the ethylene signaling pathway of Solanum lycopersicum?

ETR2 functions as a negative regulator of ethylene responses in tomato. As part of the ethylene receptor family (which includes SlETR1-SlETR6), ETR2 binds ethylene in its transmembrane domain, leading to changes in downstream signaling pathways . In the absence of ethylene, these receptors actively suppress ethylene responses; when ethylene binds, this suppression is released, allowing ethylene responses to proceed . Studies have shown that modifications in ethylene receptor expression can significantly alter plant development, particularly affecting fruit ripening, senescence, and stress responses .

How does ETR2 differ structurally and functionally from other tomato ethylene receptors?

ETR2 belongs to subfamily II of ethylene receptors, which differ structurally from subfamily I receptors. While all tomato ethylene receptors contain transmembrane domains for ethylene binding, ETR2 has a diverged histidine kinase domain that functions as a Ser/Thr kinase rather than a His kinase . This structural difference contributes to its unique signaling properties. Unlike subfamily I receptors (ETR1), ETR2 can phosphorylate its receiver domain through Ser/Thr kinase activity rather than His kinase activity . Despite these structural differences, functional studies suggest considerable redundancy among ethylene receptors, as overexpression of one receptor can often compensate for reduced expression of another .

What are the expression patterns of ETR2 during tomato fruit development?

ETR2 expression varies throughout fruit development stages, with distinct patterns observed during ripening. Targeted proteomics studies have revealed that ETR2 protein levels do not always directly correlate with mRNA abundance, suggesting post-transcriptional regulation . The expression pattern typically shows increases during the ripening phase, paradoxically coinciding with increased ethylene sensitivity. This apparent contradiction is resolved by understanding that ethylene production also increases dramatically during ripening, potentially saturating the receptors despite their increased abundance .

Developmental StageRelative ETR2 mRNA ExpressionRelative ETR2 Protein Level
Immature Green (IMG)Low to moderateLow
Mature Green (MG)ModerateModerate
Breaker (Br)IncreasingIncreasing
Breaker + 8 days (Br8)HighHigh

Note: Expression levels vary based on cultivation conditions and specific tomato varieties. This table represents typical patterns observed in wild-type tomatoes based on published research .

How do mutations in the ETR2 gene affect ethylene perception and downstream signaling in tomato?

Specific mutations in ETR2 can profoundly alter ethylene sensitivity and downstream responses. Gain-of-function mutations typically result in ethylene insensitivity due to the receptor remaining locked in the "on" state (constitutively suppressing ethylene responses), while loss-of-function mutations can enhance ethylene sensitivity . Research using TILLING (Targeting Induced Local Lesions In Genomes) approaches has identified specific amino acid changes in the transmembrane domain that dramatically affect ethylene binding capability .

Interestingly, the effects of ETR2 mutations are context-dependent—the same mutation may produce different phenotypes depending on the developmental stage or tissue examined. For example, mutations affecting the N-box of the kinase domain abolish kinase activity, which impacts ethylene signaling capabilities . Researchers should consider these context-dependent effects when designing experiments to study ETR2 function.

What compensatory mechanisms exist among ethylene receptors when ETR2 expression is altered?

Tomato ethylene receptors exhibit remarkable functional redundancy and compensatory mechanisms. Studies reveal that reduced expression of one receptor often triggers upregulation of others to maintain ethylene signaling homeostasis . For example, transgenic lines with reduced NR (Never Ripe, another ethylene receptor) mRNA levels show elevated levels of LeETR4 mRNA, indicating a functional compensation mechanism . Similarly, overexpression of NR can eliminate the ethylene-sensitive phenotype observed in plants with reduced LeETR4 expression, suggesting functional equivalence despite structural differences .

This compensatory relationship presents significant challenges for researchers studying individual receptors, as single receptor knockdowns may not produce obvious phenotypes due to compensation by other family members. Experimental designs must account for these compensatory mechanisms through:

  • Analysis of all receptor expression levels when modifying a single receptor

  • Creation of multiple receptor mutants to overcome redundancy

  • Use of tissue-specific or inducible promoters to control timing and location of expression modifications

How does heat stress affect ETR2 expression and function in tomato reproductive tissues?

Heat stress significantly alters ETR2 expression and function, particularly in reproductive tissues like pollen. Recent studies demonstrate that tomato pollen possesses an active ethylene-biosynthesis and -signaling pathway that responds to heat stress conditions . Under high-temperature conditions, ethylene production increases in pollen grains, while specific components of the ethylene signaling pathway, including certain ethylene receptors, show modified expression patterns .

While ETR3 (also known as NR) has been specifically identified as heat-responsive in pollen, the role of ETR2 under heat stress requires further investigation . Understanding these relationships has significant implications for addressing reduced crop yields under increasing global temperatures, as pollen development and function are particularly sensitive to heat stress.

What are the optimal methods for producing recombinant Solanum lycopersicum ETR2?

Production of recombinant ETR2 presents significant challenges due to its membrane-localized nature. The following methodological approach has proven effective:

  • Gene Cloning and Expression Vector Selection:

    • Amplify the ETR2 coding sequence from tomato cDNA using high-fidelity polymerase

    • Clone into expression vectors with affinity tags (His6 or GST) positioned to avoid interference with the transmembrane domain

    • Consider using eukaryotic expression systems (yeast or insect cells) that better accommodate membrane proteins than bacterial systems

  • Protein Expression Optimization:

    • For membrane proteins like ETR2, expression in Pichia pastoris has shown superior results compared to E. coli

    • Optimize induction conditions, including temperature (typically 18-20°C), inducer concentration, and duration

    • Consider adding stabilizing agents during expression (glycerol at 5-10%)

  • Solubilization and Purification:

    • Isolate membrane fractions through differential centrifugation

    • Solubilize with mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Purify using affinity chromatography followed by size exclusion chromatography

  • Verification of Functional Activity:

    • Assess ethylene binding capabilities using radiolabeled ethylene

    • Verify kinase activity through autophosphorylation assays

    • Confirm proper folding through circular dichroism spectroscopy

How can targeted proteomics be implemented to quantify ETR2 protein levels in tomato tissues?

Targeted proteomics approaches, particularly Parallel Reaction Monitoring (PRM), have proven effective for quantifying low-abundance proteins like ethylene receptors in tomato tissues . The following methodology is recommended:

  • Sample Preparation:

    • Extract membrane proteins from tomato tissues using microsomal preparation methods

    • Fractionate proteins through SDS-PAGE to enrich for the appropriate molecular weight range

    • Perform in-gel digestion with trypsin for consistent peptide generation

  • Peptide Selection and Method Development:

    • Conduct in silico analysis to identify ETR2-specific proteotypic peptides

    • Synthesize labeled versions of selected peptides as internal standards

    • Develop a PRM method with optimized transitions for each target peptide

  • LC-MS/MS Analysis:

    • Use nano-HPLC coupled to a high-resolution mass spectrometer (e.g., Quadrupole Orbitrap)

    • Optimize chromatographic separation for hydrophobic peptides from membrane proteins

    • Measure both synthetic labeled peptides and endogenous peptides simultaneously

  • Data Analysis and Quantification:

    • Use specialized software (Skyline) to extract and integrate chromatographic peaks

    • Calculate relative quantification using peak area ratios between endogenous and synthetic peptides

    • Compare protein abundance across different developmental stages or treatments

This approach allows reliable detection and quantification of ETR2 despite its low abundance, providing crucial insights into protein-level regulation that transcriptomic approaches cannot reveal .

What genetic approaches are most effective for studying ETR2 function in vivo?

Multiple complementary genetic approaches have proven effective for investigating ETR2 function in vivo:

  • TILLING for Identification of ETR2 Mutants:

    • TILLING represents an efficient reverse genetics approach for identifying mutations in tomato ETR2

    • The Micro-Tom TILLING platform, with EMS mutation frequency of one mutation per 737 kb, provides an effective resource for identifying multiple allelic variants

    • Screening for mutations specifically in the transmembrane domain yields variants with altered ethylene sensitivity

  • RNA Interference (RNAi) and Antisense Approaches:

    • RNAi constructs targeting ETR2-specific sequences can reduce expression levels

    • Antisense constructs provide an alternative approach for receptor downregulation

    • Both approaches require careful design to ensure specificity among the closely related ethylene receptor family members

  • CRISPR/Cas9 Gene Editing:

    • CRISPR/Cas9 allows precise modification of the ETR2 gene

    • Design gRNAs targeting conserved functional domains for knockout studies

    • Alternatively, introduce specific amino acid substitutions to study structure-function relationships

  • Overexpression and Complementation Studies:

    • Constitutive or inducible overexpression reveals gain-of-function phenotypes

    • Cross different receptor mutants to study functional redundancy

    • Complement receptor mutants with wild-type or modified versions to confirm specificity

When implementing these approaches, researchers should systematically analyze:

  • Multiple independent transgenic/mutant lines to control for position effects

  • Expression levels of all ethylene receptors to identify compensatory changes

  • Ethylene responses across different developmental stages and tissues

How should researchers interpret discrepancies between ETR2 transcript and protein levels?

Discrepancies between ETR2 mRNA and protein abundance are common and provide important insights into post-transcriptional regulation . To properly interpret such discrepancies:

  • Calculate Correlation Coefficients:

    • Pearson correlations between mRNA and protein profiles serve as indicators to discriminate between genotypes

    • Wild-type plants typically show positive correlations, while mutations in ethylene signaling (e.g., Never-Ripe) disrupt these correlations

  • Analyze Temporal Patterns:

    • Examine time lags between mRNA and protein peaks

    • Determine if protein levels plateau despite decreasing transcript levels, indicating protein stability differences

  • Consider Regulatory Mechanisms:

    • Investigate microRNA-mediated regulation of ETR2 transcript

    • Assess protein turnover rates through pulse-chase experiments

    • Examine post-translational modifications affecting protein stability

  • Context-Dependent Interpretation:

    • During fruit ripening, transcript-protein discrepancies may reflect rapid changes in ethylene production

    • Under stress conditions, post-transcriptional regulation may be enhanced

What experimental controls are essential when studying recombinant ETR2 function in heterologous systems?

When characterizing recombinant ETR2 in heterologous systems, the following controls are essential for reliable data interpretation:

  • Expression Controls:

    • Empty vector controls to assess background activity

    • Known functional ethylene receptor (e.g., ETR1) as positive control

    • Protein expression verification through Western blotting or fluorescent tagging

  • Functional Validation Controls:

    • Known inactive mutant version (e.g., mutation in ethylene binding domain)

    • Kinase-dead mutant (mutation in N-box of kinase domain)

    • Complementation of receptor-deficient systems to confirm functionality

  • Binding Assay Controls:

    • Competitive binding with unlabeled ethylene to demonstrate specificity

    • Binding assays with known ethylene binding inhibitors (e.g., 1-MCP)

    • Temperature controls to distinguish between specific binding and nonspecific interactions

  • Activity Assay Controls:

    • Time course measurements to determine optimal reaction conditions

    • Substrate concentration gradients to determine kinetic parameters

    • Inclusion of phosphatase inhibitors when assessing kinase activity

These controls ensure that observed activities are specific to ETR2 and not artifacts of the expression system or experimental conditions.

What are the most promising approaches for investigating ETR2's role in tomato heat stress responses?

Given the emerging evidence linking ethylene signaling to heat stress responses in tomato , several promising approaches for investigating ETR2's specific role include:

  • Tissue-Specific Expression Analysis:

    • Compare ETR2 expression patterns in reproductive vs. vegetative tissues under heat stress

    • Use laser capture microdissection to isolate specific cell types (e.g., pollen tubes, tapetum) for precise expression analysis

    • Develop tissue-specific promoter-reporter constructs to visualize real-time expression changes

  • Heat-Responsive Phosphoproteomics:

    • Implement quantitative phosphoproteomics to identify heat-induced changes in ETR2 phosphorylation status

    • Map heat-responsive phosphorylation sites to functional domains

    • Determine if heat stress affects ETR2 kinase activity or substrate specificity

  • Protein-Protein Interaction Networks:

    • Identify heat-specific ETR2 interaction partners using proximity labeling approaches

    • Compare interaction networks under normal and heat stress conditions

    • Investigate whether heat stress affects receptor complex formation or stability

  • Functional Analysis Using Temperature-Sensitive Mutants:

    • Generate and characterize temperature-sensitive ETR2 variants

    • Determine whether heat affects ethylene binding capacity of ETR2

    • Investigate if heat stress alters receptor turnover or membrane localization

How might understanding ETR2 function contribute to developing climate-resilient tomato varieties?

ETR2's role in ethylene signaling positions it as a potential target for developing tomatoes with enhanced climate resilience . Strategic approaches include:

  • Targeted Modification of ETR2 Heat Responsiveness:

    • Identify naturally occurring ETR2 variants with enhanced stability under high temperatures

    • Engineer modified ETR2 proteins with optimized function under heat stress

    • Develop tomato lines with fine-tuned ETR2 expression that maintains reproductive development under elevated temperatures

  • Exploitation of ETR2-Dependent Stress Response Pathways:

    • Map downstream signaling components specifically regulated by ETR2

    • Identify ETR2-dependent transcriptional networks activated during heat stress

    • Target these pathways to enhance pollen viability and fruit set under elevated temperatures

  • Cross-Talk Analysis Between ETR2 and Other Stress Signaling Pathways:

    • Investigate interactions between ETR2-mediated signaling and other stress hormone pathways (ABA, salicylic acid)

    • Determine if ETR2 signaling affects heat shock protein expression or accumulation

    • Develop integrated models of ETR2's role in multiple stress response networks

These approaches could lead to targeted breeding strategies or biotechnological interventions that enhance tomato productivity under increasingly variable climate conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.