Recombinant Solanum lycopersicum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction

NAD(P)H-quinone oxidoreductases (NQOs) are a class of enzymes that catalyze the two-electron reduction of quinones to hydroquinones, utilizing NADH or NADPH as electron donors . In plants, NQOs play a crucial role in various metabolic processes, including photosynthesis, respiration, and antioxidant defense . The ndhC gene encodes a subunit of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which is involved in cyclic electron flow around photosystem I (PSI) and chlororespiration .

Structure and Function

The NDH complex is a multi-subunit enzyme complex located in the thylakoid membranes of chloroplasts . It is composed of several subunits, including NdhC, which are essential for its assembly and function. The NDH complex mediates the transfer of electrons from NAD(P)H to plastoquinone, contributing to the regulation of the photosynthetic electron transport chain and the protection against photoinhibition .

Importance in Photosynthesis

The NDH complex plays a vital role in regulating the balance between linear and cyclic electron flow in photosynthesis. Cyclic electron flow around PSI is important under stress conditions, such as high light intensity or drought, as it generates a proton gradient that drives ATP synthesis without producing NADPH . This helps to maintain the ATP/NADPH ratio and protect the photosynthetic apparatus from damage.

Role in Chlororespiration

In addition to its role in photosynthesis, the NDH complex is also involved in chlororespiration, a process that allows plants to oxidize carbohydrates in the dark using oxygen as the final electron acceptor . Chlororespiration is important for maintaining energy production and redox balance in chloroplasts during periods of darkness or stress.

Research Findings

  • Substrate specificity NAD(P)H quinone oxidoreductases from the same organism have complimentary substrate specificity profiles . For example, paAzoR1 has a preference for benzoquinones, while paAzoR3 prefers naphthoquinones, and paAzoR2 reduces both benzoquinones and naphthoquinones efficiently .

  • Active site size The size of the active site affects substrate specificity . paAzoR2 and paAzoR3 are thought to have significantly larger active sites than paAzoR1, allowing them to accommodate larger quinone groups .

  • Inhibitory activity Molecular modeling studies have explored the interactions of naphthoquinone derivatives with the β5 and β6 subunits of the 20S proteasome, revealing that the chloronaphthoquinone and the sulfonamide moieties are critical for inhibitory activity .

Glycoalkaloids of Solanaceae

Glycoalkaloids, found in plants of the Solanaceae family like potato (S. tuberosum), are secondary metabolites with potential pharmacological activities . α-Solanine and α-chaconine, two major glycoalkaloids, have shown antimicrobial, insecticidal, and fungicidal properties . These compounds can be extracted from plants and analyzed for their biological activities and toxicity, which could be useful in developing new pharmacological agents .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDFFWAFLIISILVPILAFFISGVLAPISKGPEKLSTYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This redox reaction is coupled with proton translocation, conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of ndhC in Solanum lycopersicum?

The ndhC gene in Solanum lycopersicum (tomato) is located in the chloroplast genome and encodes the NdhC subunit of the NAD(P)H dehydrogenase (NDH) complex. One of the most notable characteristics of this gene is its partial overlap with the downstream ndhK gene, a feature conserved across many plant species including tobacco and tomato . This overlapping gene arrangement creates a complex expression unit where both genes are cotranscribed along with the downstream ndhJ gene to produce a major 2-kb tricistronic transcript . The proximity and partial overlap between these genes suggest strong evolutionary conservation, likely due to functional constraints related to coordinated expression and assembly of the NDH complex components. This genomic arrangement necessitates specialized translation mechanisms to ensure proper stoichiometry of the encoded proteins.

What is the function of the NAD(P)H dehydrogenase complex in chloroplasts?

The chloroplast NAD(P)H dehydrogenase (NDH) complex, of which NdhC is a critical component, plays essential roles in photosystem I cyclic electron transport and chlororespiration . The complex consists of more than 25 subunits, with 11 encoded in the chloroplast genome, including ndhC . This multiprotein complex facilitates alternative electron flow pathways that supplement linear electron transport, particularly under stress conditions. The NDH complex contributes to photoprotection by preventing over-reduction of the electron transport chain, especially under fluctuating light or environmental stress conditions. Additionally, the complex participates in chlororespiration, a respiratory electron transport pathway in chloroplasts that operates in the dark and helps maintain redox balance. Recent research has increasingly highlighted the importance of this complex in optimizing photosynthetic efficiency and stress tolerance in plants, making it a significant target for crop improvement strategies.

How is the expression of ndhC regulated in response to environmental stresses?

While specific information about ndhC regulation in response to environmental stresses is limited in the provided search results, we can draw some insights from related research on chloroplast genes in Solanum lycopersicum. Recent studies have shown that various stress factors, particularly salt stress, can influence the expression of chloroplast genes . For instance, genes involved in salt stress response such as cation/proton exchanger (CHX), salt overly sensitive (SOS), and receptor-like kinase (RLK) genes show upregulated expression under salt stress conditions, with fold changes of 1.83, 1.49, and 1.55, respectively, after 12 hours of exposure . The NDH complex, including ndhC, is known to play important roles in stress responses, particularly under conditions that affect photosynthetic efficiency. The expression of ndhC likely responds to environmental stressors that affect the redox state of chloroplasts, including high light intensity, drought, temperature extremes, and salt stress. Understanding these regulatory mechanisms requires analyses of transcript levels, protein accumulation, and complex assembly under various stress conditions.

What unique translation mechanisms govern ndhC and ndhK expression?

In vitro studies using a translation system from tobacco chloroplasts have demonstrated that free ribosomes can enter at an internal AUG start codon located in-frame within the ndhC cistron . These ribosomes, carrying formylmethionyl-tRNA fMet, translate the 3' half of the ndhC cistron and, upon reaching the ndhK start codon, some ribosomes continue to translate the ndhK cistron . This mechanism produces a 57-amino-acid peptide corresponding to the sequence from the internal AUG to the ndhC stop codon, which represents a metabolic cost that appears justified by the need to deliver additional ribosomes to the ndhK cistron . This sophisticated arrangement ensures that NdhK is produced in quantities required for proper assembly of the functional NDH complex.

How can researchers effectively design experiments to study ndhC function in Solanum lycopersicum?

Designing rigorous experiments to study ndhC function requires careful consideration of variables, appropriate controls, and precise measurement techniques. Following established experimental design principles, researchers should first clearly define their variables . The independent variables might include environmental conditions (light intensity, temperature, salt concentration), genetic modifications to ndhC, or treatments affecting chloroplast function. Dependent variables typically include NDH complex activity, photosynthetic efficiency, stress tolerance, or growth parameters .

A strong experimental design for studying ndhC should follow these key steps:

  • Formulate specific, testable hypotheses about ndhC function

  • Design appropriate treatments to manipulate the independent variables

  • Assign experimental units to treatment groups using randomization to minimize bias

  • Plan precise methods to measure dependent variables, potentially including:

    • Chlorophyll fluorescence to assess NDH activity

    • Gas exchange measurements to evaluate photosynthetic performance

    • RT-qPCR to quantify ndhC expression levels

    • Protein analysis techniques to assess NdhC accumulation

    • Physiological measurements to evaluate stress responses

Control for extraneous variables that might confound results, such as developmental stage, circadian rhythms, or microenvironmental variations . When designing genetic studies, consider using approaches such as introgression lines or genetic transformation to manipulate ndhC expression or sequence while maintaining the appropriate genetic background .

What techniques are most effective for analyzing ndhC expression at transcript and protein levels?

Several complementary techniques provide robust analysis of ndhC expression at both transcript and protein levels. For transcript analysis, quantitative reverse transcription PCR (qRT-PCR) represents a sensitive and reliable method for quantifying ndhC mRNA abundance under various conditions or in different genotypes . When designing qRT-PCR experiments, researchers should carefully select reference genes that show stable expression across the experimental conditions and follow MIQE guidelines for experimental design and reporting.

For more comprehensive transcriptome analysis, RNA sequencing (RNA-Seq) can provide insights into expression patterns of ndhC along with thousands of other genes, allowing for identification of coregulated gene networks. Northern blotting, though less quantitative, can be valuable for visualizing the tricistronic transcript containing ndhC, ndhK, and ndhJ, confirming their cotranscription and examining transcript processing or stability.

At the protein level, Western blotting using antibodies specific to NdhC provides information about protein accumulation and stability. Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by immunoblotting is particularly valuable for examining NdhC incorporation into the NDH complex and assessing complex assembly under different conditions. For detailed structural and functional studies, techniques such as co-immunoprecipitation can identify protein-protein interactions involving NdhC, while proteomics approaches using mass spectrometry can provide insights into post-translational modifications that might regulate NdhC function or complex assembly.

How do homeologous recombination techniques apply to ndhC research in Solanum species?

Homeologous recombination techniques represent powerful tools for studying ndhC function through interspecific genetic exchange. Studies with Solanum lycopersicoides introgression lines in the genetic background of cultivated tomato have demonstrated that recombination between homeologous chromosomes occurs at reduced frequencies compared to homologous recombination, ranging from as little as 0-10% of expected frequencies . These reduced recombination rates present challenges for transferring desirable traits or creating genetic resources for functional studies of genes like ndhC across Solanum species.

Several factors influence homeologous recombination efficiency:

  • The length of introgressed segments positively correlates with recombination rates, with longer introgressions showing up to 40-50% of normal recombination frequencies

  • Double-introgression lines containing two homeologous segments on opposite chromosome arms demonstrate increased recombination compared to single segment lines

  • Crossing with phylogenetically intermediate species significantly enhances homeologous recombination

Recombination ScenarioRelative Recombination RateNotes
Short introgressed segments0-10% of expectedMinimal recombination
Long introgressions or substitution linesUp to 40-50% of normalSignificantly higher recombination
Double-introgression linesHigher than single segment linesDespite preference for crossovers in homologous regions
With phylogenetically intermediate speciesHighest rates observedEspecially in overlapping segments

These principles can be applied to develop genetic resources for studying ndhC function by creating introgression lines carrying different ndhC alleles from wild Solanum species, potentially introducing natural variation that can provide insights into structure-function relationships or adaptive significance of sequence polymorphisms .

What are the best approaches for isolating and characterizing recombinant NdhC protein?

Isolating and characterizing recombinant NdhC protein presents significant challenges due to its hydrophobic nature and location within a multiprotein complex in the thylakoid membrane. A systematic approach combining molecular biology, biochemistry, and structural biology techniques yields the most comprehensive results. The process typically begins with designing an expression construct containing the ndhC coding sequence, potentially with affinity tags to facilitate purification. For heterologous expression, bacterial systems like Escherichia coli may be used with specialized strains designed for membrane protein expression, though eukaryotic systems such as yeast or insect cells may provide more appropriate folding environments.

Purification strategies should account for NdhC's membrane localization, typically employing:

  • Detergent solubilization using mild non-ionic detergents that maintain protein structure

  • Affinity chromatography utilizing engineered tags

  • Size exclusion chromatography to separate individual NdhC from the intact complex

  • Ion exchange chromatography for further purification

Characterization of the purified protein should address multiple aspects of structure and function:

  • Protein integrity verification through SDS-PAGE and Western blotting

  • Secondary structure analysis via circular dichroism spectroscopy

  • Functional assessment through reconstitution experiments or activity assays

  • Interaction studies using techniques like isothermal titration calorimetry or surface plasmon resonance

  • Structural investigations via X-ray crystallography or cryo-electron microscopy for high-resolution insights

The specific experimental conditions require careful optimization for each step, with particular attention to detergent selection, buffer composition, and stabilizing agents that maintain NdhC in its native conformation throughout the purification and characterization process.

How can researchers effectively analyze the unique translational coupling of ndhC and ndhK genes?

The unique translational coupling between ndhC and ndhK genes requires specialized experimental approaches to understand the mechanisms governing their coordinated expression. In vitro translation systems derived from tobacco chloroplasts have proven particularly valuable for studying this complex process . These systems allow researchers to observe the entry of ribosomes at both the conventional 5'UTR start site and the internal AUG start codon within the ndhC coding sequence, as well as monitor the translation of both cistrons .

To effectively analyze this translational coupling, researchers should consider employing a combination of techniques:

  • Construct Engineering: Create reporter gene constructs with modifications to potential regulatory elements, including:

    • Mutations at the internal AUG start codon

    • Alterations to the overlap region between ndhC and ndhK

    • Introduction of reporter genes fused to each cistron

    • Modifications of potential RNA secondary structures

  • In Vitro Translation Assays: Utilizing chloroplast extracts to directly monitor translation products, researchers can:

    • Track the synthesis of the 57-amino-acid peptide produced from internal initiation

    • Measure relative translation efficiencies of ndhC and ndhK

    • Evaluate the effects of mutations on translational coupling

    • Assess the impact of trans-acting factors on translation

  • Ribosome Profiling: This technique provides genome-wide information on ribosome positions and can reveal:

    • Ribosome occupancy at start codons and throughout the coding sequences

    • Pausing sites that might influence translational coupling

    • Evidence of alternative translation initiation sites

    • Quantitative measures of translation efficiency

  • RNA Structure Analysis: Since RNA secondary structure often influences translation initiation and efficiency, methods such as SHAPE (Selective 2'-hydroxyl acylation analyzed by primer extension) can map RNA structures relevant to translational coupling.

These approaches, used in combination, can provide comprehensive insights into the complex mechanisms ensuring appropriate stoichiometry of NdhC and NdhK proteins despite their unusual gene arrangement .

What genome editing techniques are most appropriate for studying ndhC function in tomato?

Studying ndhC function in tomato presents unique challenges as this gene resides in the chloroplast genome rather than the nuclear genome. This location necessitates specialized approaches for genetic manipulation. While CRISPR/Cas9 has revolutionized nuclear genome editing, chloroplast transformation requires alternative techniques. The most established method for chloroplast genome modification is biolistic transformation with DNA constructs containing homologous flanking sequences that facilitate targeted recombination into the plastid genome.

For ndhC functional studies, researchers might employ several strategic approaches:

  • Site-directed mutagenesis via plastid transformation:

    • Design transformation vectors containing modified ndhC sequences flanked by homologous regions

    • Introduce precise mutations to study structure-function relationships

    • Create knockout lines by inserting selectable markers within the ndhC coding sequence

    • Generate transplastomic lines with tagged versions of NdhC for localization or interaction studies

  • Complementation strategies:

    • In ndhC-deficient backgrounds, introduce wild-type or modified versions to assess functional complementation

    • Express ndhC variants from different species to examine evolutionary conservation of function

    • Create chimeric ndhC genes to identify functional domains

  • Inducible systems for studying essential functions:

    • Develop nuclear-encoded, chloroplast-targeted RNA interference constructs against ndhC

    • Create inducible expression systems for modified ndhC variants

    • Employ synthetic biology approaches with orthogonal translation systems

  • Selection and screening considerations:

    • Utilize antibiotic resistance markers specifically effective in chloroplasts (spectinomycin, streptomycin)

    • Implement visual markers like GFP for identifying transformed chloroplasts

    • Develop screening methods based on photosynthetic phenotypes related to NDH complex function

Successfully edited lines must undergo extensive validation to confirm homoplasmy (complete replacement of wild-type chloroplast genomes with the modified version) through molecular analysis and phenotypic characterization under various environmental conditions.

How should researchers interpret apparent contradictions in ndhC expression data across different experimental systems?

Contradictory data regarding ndhC expression across different experimental systems presents a significant challenge that requires careful analysis and interpretation. Several factors might contribute to these discrepancies, including differences in experimental conditions, genetic backgrounds, developmental stages, or analytical techniques. Rather than dismissing contradictions, researchers should systematically examine potential sources of variation and use these differences to gain deeper insights into regulatory mechanisms.

When confronted with contradictory ndhC expression data, researchers should consider:

  • Experimental system differences:

    • In vitro versus in vivo systems may reflect fundamentally different regulatory environments

    • Heterologous expression systems may lack specific factors present in native chloroplasts

    • Tissue culture conditions might alter chloroplast development and gene expression

    • Field versus controlled environment studies may reveal environment-specific regulation

  • Genetic background effects:

    • Introgression lines with different genetic backgrounds can influence expression patterns

    • Variations in trans-acting factors between genotypes might affect ndhC regulation

    • Epigenetic differences between experimental systems could impact expression

  • Methodological considerations:

    • Different measurement techniques vary in sensitivity, specificity, and dynamic range

    • RNA versus protein measurements might reveal post-transcriptional regulation

    • Timing of measurements may capture different aspects of dynamic responses

  • Biological complexity:

    • Internal translation initiation within ndhC creates complexity in expression analysis

    • Overlap with ndhK adds another layer of regulatory intricacy

    • Tissue-specific or developmental regulation might explain some contradictions

    • Environmental responses may occur on different timescales for different aspects of regulation

Rather than viewing contradictions as experimental failures, they should be recognized as opportunities to develop more sophisticated models of ndhC regulation that incorporate multiple layers of control operating under different conditions or in different genetic backgrounds.

What statistical approaches are most appropriate for analyzing ndhC expression data under varying experimental conditions?

For comparing ndhC expression across different treatments or genotypes, several approaches may be appropriate:

  • For normally distributed data with homogeneous variance:

    • Student's t-test for comparing two groups

    • Analysis of variance (ANOVA) for multiple groups, followed by post-hoc tests like Tukey's HSD

    • Linear mixed-effects models when including random factors (e.g., biological replicates)

  • For non-normally distributed data or when homogeneity of variance cannot be assumed:

    • Non-parametric tests such as Mann-Whitney U or Kruskal-Wallis

    • Permutation tests that do not rely on distributional assumptions

    • Transformation of data (log, square root) before parametric analysis

  • For time-series expression data:

    • Repeated measures ANOVA when assumptions are met

    • Linear mixed models with time as a fixed effect

    • Generalized additive models for complex temporal patterns

  • For multivariate analysis of gene expression networks:

    • Principal component analysis to reduce dimensionality

    • Cluster analysis to identify co-expressed genes

    • Network analysis to understand regulatory relationships

  • For integrating multiple data types:

    • Partial least squares regression for relating expression to phenotypic data

    • Structural equation modeling for testing causal hypotheses

    • Machine learning approaches for complex pattern recognition

Regardless of the chosen method, researchers should report effect sizes alongside p-values, perform appropriate corrections for multiple testing (e.g., Bonferroni, FDR), and validate findings with independent datasets or biological replicates whenever possible .

How might understanding ndhC function contribute to improving crop stress tolerance?

The NDH complex, of which NdhC is an essential component, plays crucial roles in photosynthetic efficiency and stress responses in plants. Understanding ndhC function could provide valuable insights for improving crop stress tolerance through various mechanisms. The complex's involvement in cyclic electron transport and chlororespiration positions it as a key player in photoprotection during environmental stresses that affect photosynthesis .

Several potential applications emerge from deeper understanding of ndhC function:

  • Enhanced photoprotection under fluctuating light conditions:

    • Engineering optimized NDH complex components could improve energy dissipation during high light stress

    • Modified ndhC variants might enhance cyclic electron flow capacity when linear electron transport is inhibited

    • Improved regulation of NDH activity could help plants cope with rapidly changing light environments in field conditions

  • Increased tolerance to temperature extremes:

    • The NDH complex's role in maintaining redox balance becomes particularly important under temperature stress

    • Enhanced NDH function could improve photosynthetic performance during heat stress events

    • Cold tolerance might be improved through optimized chlororespiration pathways involving the NDH complex

  • Salt and drought stress tolerance:

    • Given that chloroplast genes respond to salt stress, as demonstrated for other regulatory genes , optimizing ndhC function could contribute to improved salt tolerance

    • NDH-mediated cyclic electron flow helps maintain proton gradients necessary for energy production when water is limiting

    • The complex may contribute to ROS management during drought stress

  • Integration with other stress response pathways:

    • Coordinated engineering of ndhC with salt stress response genes like SOS pathway components could provide synergistic improvements

    • Combining optimized NDH function with enhanced antioxidant systems might offer robust stress protection

Translating this understanding into practical applications would likely involve identifying natural variation in ndhC sequences across wild relatives of crops, potentially utilizing techniques like homeologous recombination to introduce beneficial alleles , and employing chloroplast transformation strategies to directly modify ndhC in elite crop varieties.

What are the most promising future research directions for understanding the evolution of the unique ndhC-ndhK gene arrangement?

The unusual overlapping arrangement of ndhC and ndhK genes, together with their sophisticated translational coupling mechanism, presents fascinating questions about evolutionary origins and selective pressures. Future research into this unique genomic feature could explore several promising directions:

  • Comparative genomic approaches:

    • Systematic analysis of ndhC-ndhK arrangements across diverse plant lineages to understand evolutionary conservation

    • Identification of transitional states or alternative arrangements in early-diverging plant groups

    • Investigation of convergent evolution of overlapping gene arrangements in organellar genomes

  • Evolutionary rate analysis:

    • Examination of selection pressures on ndhC and ndhK using methods similar to those applied to other chloroplast genes

    • Assessment of Ka/Ks ratios to determine if purifying selection has maintained this arrangement, as observed for other chloroplast genes

    • Identification of coevolving residues between NdhC and NdhK that might reflect functional constraints

  • Experimental evolution approaches:

    • Creating synthetic arrangements with altered overlap regions to test hypotheses about optimal gene organization

    • Laboratory evolution experiments with modified ndhC-ndhK arrangements to observe compensatory changes

    • Testing fitness consequences of alternative gene arrangements under various selection pressures

  • Structural biology investigations:

    • Detailed structural analysis of how NdhC and NdhK interact within the NDH complex

    • Examination of whether protein interaction constraints might explain gene arrangement

    • Investigation of how the 57-amino-acid peptide produced from internal initiation might influence complex assembly

  • Translation efficiency modeling:

    • Computational models of ribosome dynamics on the ndhC-ndhK transcript

    • Predictions of evolutionary trajectories that might have led to the current arrangement

    • Simulation of alternative arrangements to understand potential advantages of the overlapping configuration

These research directions could provide fundamental insights into organellar genome evolution, constraints on gene arrangement, and the complex interplay between genomic organization and protein expression that shapes chloroplast function across plant lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.