Recombinant Solanum lycopersicum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant ndhE

Recombinant Solanum lycopersicum NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a bioengineered protein derived from tomato (Solanum lycopersicum) chloroplasts. This subunit is part of the NAD(P)H dehydrogenase (NDH) complex, which plays a critical role in photosynthetic electron transport and redox regulation .

PropertyDetail
Uniprot IDQ2MI48
Gene NamendhE
Expression HostE. coli
TagN-terminal His-tag (determined during production)
Sequence Length1–101 amino acids (full-length)
Storage BufferTris-based buffer with 50% glycerol

Amino Acid Sequence and Biochemical Features

The recombinant ndhE protein includes a His-tag for purification and has an apparent molecular weight of ~11 kDa (1–101 residues) . Key structural motifs include:

  • Iron-sulfur clusters: Critical for electron transfer .

  • FMN-binding domains: Facilitate oxidation-reduction reactions .

Residue PositionSequence Fragment
1–10MILEHVLVLS
11–20AYLFSIGIYGL
91–101IFSIFVIAIAAAEAAIGLAIVSSIYRNR

Source:

Functional Role in Chloroplasts

ndhE is a core subunit of the NDH complex, which shuttles electrons from NAD(P)H to plastoquinone in the chloroplast thylakoid membrane . Key functions include:

  1. Electron transport: Couples NAD(P)H oxidation to proton translocation, generating a proton gradient for ATP synthesis .

  2. Redox regulation: Mitigates oxidative stress by reducing reactive quinones .

Experimental Use in Studies

The recombinant ndhE protein is primarily utilized in:

  • ELISA assays: For quantifying ndhE levels in tomato tissues .

  • Protein interaction studies: To investigate NDH complex assembly and stability .

Pathway Involvement

ndhE is central to oxidative phosphorylation in plants, as outlined in the KEGG pathway ko00190 . Its role aligns with:

Pathway ComponentRole
NAD(P)H:quinone oxidoreductaseElectron donor to plastoquinone
Proton translocationMaintains thylakoid membrane potential

Research Gaps and Future Directions

While recombinant ndhE is available for experimental use , direct studies on its functional dynamics in tomato remain limited. Prioritizing research on:

  1. Salt stress responses: Potential links to SOS gene networks in tomato .

  2. Protein stability: Interactions with chloroplast chaperones (e.g., HSPs) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: sly:3950380

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase subunit 4L in tomato plants?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a critical component of the chloroplastic electron transport chain in Solanum lycopersicum. This protein functions within the NAD(P)H dehydrogenase complex, which catalyzes electron transfer from NAD(P)H to plastoquinone, participating in cyclic electron flow around photosystem I. This process helps maintain optimal ATP/NADPH ratios during photosynthesis, particularly under stress conditions. The protein is nuclear-encoded but functions specifically within the chloroplast organelle, making it an interesting subject for studying nuclear-chloroplast coordination.

The NAD(P)H-quinone oxidoreductase complex plays significant roles in photoprotection mechanisms and contributes to photosynthetic efficiency under varying environmental conditions. Understanding this protein's function provides insights into fundamental processes of energy conversion in plants.

How is ndhE genetically characterized in the tomato genome?

The ndhE gene in Solanum lycopersicum appears to be related to the gene family that includes LOC101268280, which encodes NAD(P)H-quinone oxidoreductase subunit L, chloroplastic . According to genomic data, the tomato genome (Assembly SL3.0) contains 34,658 coding genes with a golden path length of 827,747,456 base pairs . The specific genomic location, intron-exon structure, and regulatory elements of the ndhE gene would be important considerations for researchers studying its expression patterns.

Evolutionary analysis suggests conservation of this gene across Solanaceae family members, reflecting its essential role in chloroplast function. Gene annotation databases provide valuable resources for identifying regulatory motifs and potential interaction partners that may influence ndhE expression and function.

What structural features characterize the ndhE protein?

The ndhE protein contains characteristic domains for electron transport, including NAD(P)H binding sites and interfaces for interaction with other subunits of the NAD(P)H dehydrogenase complex. As a chloroplastic protein, it contains a transit peptide sequence that directs its import into the chloroplast after cytosolic synthesis. This protein likely undergoes posttranslational modifications that regulate its activity and stability within the chloroplast environment.

Understanding the structural features is essential for designing experiments involving recombinant expression, as proper folding and assembly with partner proteins are critical for functional studies. Researchers should consider these structural elements when planning mutagenesis studies or designing constructs for heterologous expression.

What expression systems are most effective for producing recombinant ndhE protein?

For recombinant production of chloroplastic proteins like ndhE, Escherichia coli expression systems have proven most effective. The K12 strain of E. coli is commonly used for recombinant protein production from plant sources, including tomato proteins . The T7 RNA polymerase system (T17 vector) serves as an efficient bacterial expression vector for such proteins. This approach involves:

  • Gene isolation from young tomato plants

  • PCR amplification of the target sequence

  • Cloning into an appropriate expression vector

  • Transformation into E. coli

  • Protein expression induction

  • Purification procedures

  • Validation using SDS-PAGE analysis

This methodology has been successfully applied to other tomato proteins and can be adapted for ndhE studies with appropriate optimization of expression conditions.

What purification strategies yield the highest quality recombinant ndhE?

Obtaining high-purity, functional ndhE protein requires careful consideration of purification methods. The optimal purification strategy depends on the expression system and the intended downstream applications. A comprehensive approach typically includes:

Purification StepMethodologyKey Considerations
Initial ExtractionCell lysis under native conditionsBuffer composition to maintain protein stability
Affinity ChromatographyHis-tag or other fusion tag purificationTag position to avoid interfering with function
Ion ExchangeSeparation based on charge propertiespH optimization for maximum separation
Size ExclusionFinal polishing stepAssessment of oligomeric state
Quality ControlSDS-PAGE and Western blottingConfirmation of purity and identity
Functional AssessmentActivity assaysVerification of protein functionality

Researchers should incorporate protease inhibitors throughout the purification process and maintain appropriate redox conditions to preserve structural integrity and function of this chloroplastic protein.

How can researchers optimize heterologous expression of ndhE?

Optimization of heterologous expression for chloroplastic proteins like ndhE requires systematic evaluation of multiple parameters:

  • Expression vector selection: The T7 promoter system has proven effective for tomato proteins, offering tight regulation and high expression levels

  • Host strain selection: E. coli K12 derivatives with reduced protease activity and enhanced disulfide bond formation may improve yield of properly folded protein

  • Induction conditions: Temperature, inducer concentration, and induction timing significantly impact protein solubility and yield

  • Codon optimization: Adapting the coding sequence to E. coli codon usage can enhance translation efficiency

  • Growth media composition: Rich versus minimal media affects protein expression rates and cellular stress responses

  • Co-expression strategies: Chaperones or partner proteins may enhance folding and stability

  • Fusion tags: Strategic placement of purification or solubility tags can improve both expression and downstream purification

Researchers should conduct small-scale expression trials to identify optimal conditions before scaling up production.

What are the key principles of experimental design for ndhE functional studies?

Robust experimental design is fundamental for obtaining reliable results in ndhE research. The design of experiments (DOE) approach provides a structured framework that researchers should apply:

  • Clearly define independent variables (e.g., protein concentration, substrate levels, environmental conditions) and dependent variables (e.g., enzyme activity, electron transport rates)

  • Identify and control potential confounding variables that could affect experimental outcomes

  • Incorporate appropriate randomization to minimize systematic bias

  • Include sufficient technical and biological replication to establish statistical reliability

  • Design experiments with adequate statistical power to detect biologically meaningful effects

  • Establish validity through appropriate controls and methodological rigor

  • Ensure replicability through detailed documentation of procedures

Following these principles helps researchers establish conclusive findings about ndhE function and avoids common pitfalls in interpretation.

How should researchers analyze ndhE activity in relation to chloroplast function?

  • Chloroplast isolation: Use sucrose gradient centrifugation to obtain intact chloroplasts for functional studies

  • Spectral analysis: Apply spectral confocal microscopy to track changes in pigment composition and protein localization within chloroplasts

  • Electron transport measurements: Quantify electron flow through specific pathways using polarographic or spectrophotometric techniques

  • Photosynthetic parameter assessment: Measure chlorophyll fluorescence parameters to evaluate photosystem II efficiency and cyclic electron flow

  • Stress response evaluation: Compare ndhE function under normal versus stress conditions to elucidate its role in stress adaptation

  • Temporal analysis: Track changes in ndhE expression and activity during developmental transitions, such as the chloroplast to chromoplast conversion during fruit ripening

These approaches provide complementary data that, when integrated, offer comprehensive insights into ndhE's role in chloroplast function.

What controls are essential in recombinant ndhE expression experiments?

Appropriate controls are critical for interpreting results from recombinant protein studies. For ndhE research, essential controls include:

Control TypePurposeImplementation
Empty vectorControls for effects of vector sequences and host responseTransform host with expression vector lacking ndhE insert
Inactive mutantNegative control for activity assaysExpress ndhE with mutation in catalytic site
Wild-type proteinBaseline for functional comparisonsExpress native protein alongside recombinant version
Expression timingControls for expression-dependent effectsHarvest cells at multiple time points post-induction
Purification controlAccounts for non-specific bindingProcess untransformed cells through purification protocol
SDS-PAGE standardsSize verificationInclude molecular weight markers to confirm protein size

How does ndhE function change during chloroplast to chromoplast transition in tomato fruit?

The chloroplast to chromoplast transition during tomato fruit ripening provides an excellent model system for studying changes in ndhE function within a developmental context. Research has revealed that:

  • The transition from chloroplasts to chromoplasts is synchronous for all plastids within a single cell

  • Intermediate plastids at the breaker stage contain both chlorophylls and carotenoids, indicating a gradual transformation rather than de novo chromoplast formation

  • Electron transport complexes, including those containing ndhE, undergo significant remodeling during this transition

  • The expression and stability of ndhE likely decreases as photosynthetic activity diminishes during fruit ripening

  • Protein-protein interactions involving ndhE may change as thylakoid membranes are reorganized

Studying these changes requires temporal analysis of ndhE expression, localization, and interaction partners throughout the ripening process, potentially revealing novel regulatory mechanisms governing plastid transitions.

What approaches can detect post-translational modifications of ndhE?

Post-translational modifications (PTMs) often regulate chloroplastic protein function in response to environmental or developmental signals. For ndhE, researchers should consider:

  • Mass spectrometry-based proteomics: Targeted approaches with enrichment for specific modifications (phosphorylation, acetylation, redox-based modifications)

  • Western blotting: Using modification-specific antibodies to track PTM status under various conditions

  • 2D gel electrophoresis: Separating modified protein forms based on charge and mass differences

  • Activity assays: Comparing enzyme kinetics before and after treatment with modifying/demodifying enzymes

  • Site-directed mutagenesis: Mutating potential modification sites to assess functional consequences

The functional significance of identified modifications should be verified through complementation studies and in vivo analyses of photosynthetic parameters.

How can genome editing approaches advance ndhE functional studies?

Modern genome editing techniques provide powerful tools for studying ndhE function in vivo. Researchers should consider:

  • CRISPR/Cas9 system for targeted gene knockouts or precise sequence modifications

  • Traditional mutagenesis approaches (EMS, fast neutron) for generating mutation libraries in tomato

  • TILLING coupled with next-generation sequencing for screening mutant populations, which has successfully identified mutations at a frequency of approximately 1 in 367 Kb in tomato EMS populations

  • RNA interference (RNAi) for conditional or tissue-specific gene silencing

  • Reporter gene fusions to study localization and expression patterns

These approaches can reveal phenotypic consequences of ndhE modification, providing insights into its physiological roles that complement in vitro biochemical studies.

What statistical approaches are most appropriate for analyzing ndhE functional data?

Statistical analysis of functional data for ndhE requires careful consideration of experimental design and data characteristics:

  • For comparing multiple experimental conditions, ANOVA with appropriate post-hoc tests is typically recommended

  • Data should be tested for normality before applying parametric statistics, with transformations applied as needed

  • Mixed models may be appropriate for experiments with multiple factors and repeated measurements

  • Power analysis should be conducted to ensure adequate sample sizes for detecting biologically meaningful effects

  • Non-parametric alternatives should be considered when data violate assumptions of parametric tests

  • Multiple testing corrections (e.g., Bonferroni, FDR) should be applied when performing numerous comparisons

As noted in qualitative data analysis literature, transparency in reporting statistical approaches is essential for enabling replication and building confidence in research findings .

How should researchers approach contradictory results in ndhE studies?

When faced with contradictory results in ndhE research, systematic investigation is required:

  • Carefully examine methodological differences between studies that may explain discrepancies

  • Consider biological variability, including differences in genetic background, developmental stage, or environmental conditions

  • Evaluate statistical approaches, including sample sizes and power calculations, to determine if differences are statistically reliable

  • Investigate potential technical artifacts or limitations specific to each experimental approach

  • Design experiments that directly address contradictions through side-by-side comparisons

  • Consider alternative hypotheses that might reconcile seemingly conflicting data

  • Implement triangulation of methods, using multiple approaches to investigate the same question

The qualitative data analysis literature emphasizes that rigorous analysis and transparent reporting are essential for resolving such contradictions effectively.

What approaches ensure reproducibility in ndhE research?

Reproducibility is a fundamental concern in scientific research. For ndhE studies, researchers can enhance reproducibility by:

  • Providing detailed methodological descriptions, including exact growth conditions, protein purification protocols, and assay parameters

  • Sharing genetic materials, constructs, and recombinant protein expression systems through repositories

  • Using standardized protocols for common procedures such as chloroplast isolation and photosynthetic measurements

  • Including all raw data and analysis scripts in publications or repositories

  • Clearly describing statistical approaches and justifying their appropriateness for the specific data

  • Conducting independent biological replicates across different times or environments

  • Implementing member checks, triangulation of methods, and peer debriefing as quality control measures

These practices increase confidence in research findings and facilitate building upon previous work in the field.

How might systems biology approaches advance understanding of ndhE function?

Systems biology offers powerful frameworks for integrating multiple data types to understand ndhE function in broader biological contexts:

  • Network analysis can reveal connections between ndhE and other components of photosynthetic machinery

  • Multi-omics integration (transcriptomics, proteomics, metabolomics) can identify emergent properties not evident from single-technique approaches

  • Mathematical modeling of electron transport processes can predict system-level consequences of ndhE mutations

  • Comparative genomics across plant species can illuminate evolutionary conservation and specialization of ndhE function

  • Machine learning approaches can identify patterns in complex datasets that may reveal novel regulatory mechanisms

These approaches complement traditional reductionist studies by placing ndhE function within the broader context of cellular physiology and organismal adaptation.

What are the most promising applications of ndhE research in crop improvement?

Understanding ndhE function has potential applications in tomato and other crop improvement strategies:

  • Engineering enhanced photosynthetic efficiency through optimized cyclic electron flow

  • Improving stress tolerance, particularly under conditions where linear electron transport is compromised

  • Modifying fruit ripening characteristics by targeting plastid transition processes

  • Enhancing nutritional quality through altered carotenoid accumulation during chromoplast development

  • Developing molecular markers for breeding programs focused on stress resilience

How can new technological advances be applied to ndhE research?

Emerging technologies offer exciting opportunities to advance ndhE research:

  • Cryo-electron microscopy for high-resolution structural analysis of ndhE within native protein complexes

  • Single-molecule techniques to study the dynamics of electron transport processes

  • Nanoscale sensors for real-time monitoring of electron flow in intact chloroplasts

  • Advanced imaging techniques for tracking protein movements during plastid transitions

  • Artificial intelligence approaches for predicting protein-protein interactions and functional consequences of sequence variations

  • Synthetic biology tools for reconstructing minimal functional units to test hypotheses about ndhE function

These technological advances can provide unprecedented insights into molecular mechanisms and spatial-temporal dynamics of ndhE function within plant cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.