Recombinant Solanum lycopersicum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene ID: Q9MUL3 (UniProt)
Amino Acid Sequence: 189 residues (1-189aa) with N-terminal His tag for purification
Expression System: Escherichia coli
Domains:

  • Conserved quinone-binding motifs

  • Transmembrane helices for thylakoid membrane integration

PropertyValueSource
Molecular Weight~22 kDa (predicted)
Subcellular LocalizationChloroplast thylakoid membrane
Structural RoleCore subunit of NDH complex

Functional Role in Photosynthesis

The NDH complex facilitates two critical processes:

  1. Cyclic Electron Transport (CET): Transfers electrons from NAD(P)H to plastoquinone, generating ATP without NADPH accumulation .

  2. Chlororespiration: Maintains redox homeostasis under stress by balancing stromal NADPH/ATP ratios .

Key Biochemical Activities:

  • Electron Transfer: Mediates electron shuttling via FMN and iron-sulfur clusters .

  • Proton Translocation: Couples redox reactions to create proton gradients for ATP synthesis .

  • Stress Response: Upregulated under drought, high/low temperature, and oxidative stress to mitigate ROS .

Recombinant Production and Applications

Expression Protocol:

  • Codon-optimized ndhG cloned into pET vectors.

  • Induced with IPTG in E. coli, followed by Ni-NTA affinity chromatography .

Research Applications:

  • Mechanistic Studies: Elucidating NDH-PSI supercomplex assembly .

  • Stress Tolerance Engineering: Overexpression in transgenic tomatoes enhances resilience to abiotic stressors .

  • Biophysical Analyses: Structural resolution via cryo-EM to map electron transport pathways .

Expression Under Stress:

Stress ConditionNDH Activity ChangeReference
High Light Intensity↑ 1.5–2.0-fold
Drought↑ 1.8-fold
Salt Stress↑ 1.49-fold

Genetic Interactions:

  • Co-expressed with SlAREB1 (ABA-responsive TF) to enhance drought tolerance .

  • Silencing ndhG disrupts CET, increasing ROS accumulation under fluctuating light .

Challenges and Future Directions

  • Structural Complexity: The NDH complex comprises 35 subunits, complicating recombinant reconstitution .

  • Functional Redundancy: Overlaps with PGR5/PGRL1 pathways require conditional knockout studies .

  • Biotechnological Potential: Engineering NDH-CET efficiency could improve crop yields under climate stress .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
ndhG
Target Protein Sequence
MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNAYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.