Recombinant Solanum lycopersicum Photosystem II CP47 chlorophyll apoprotein

Shipped with Ice Packs
In Stock

Description

Overview of CP47 in Photosystem II

CP47 (encoded by psbB) is a chlorophyll-binding protein essential for light harvesting and electron transfer in PSII. It forms part of the PSII core complex alongside CP43, D1, D2, and extrinsic oxygen-evolving enhancer (OEE) proteins . Key roles include:

  • Light absorption: Binds 16 chlorophyll a molecules and β-carotene .

  • Reaction center stabilization: Coordinates with D1/D2 heterodimer and OEE proteins .

  • Assembly: Recruits CP47 to the PSII core complex after D1/D2 assembly .

Protein Architecture

CP47 is a hydrophobic protein with 6 transmembrane α-helices, stabilized by histidine residues that ligate chlorophyll molecules . In spinach, the recombinant CP47 protein spans 508 amino acids (aa 1–508) with an N-terminal His-tag for purification . Structural homology with Photosystem I (PSI) subunits (e.g., PsaA/PsaB) suggests conserved chlorophyll-binding motifs .

FeatureSpinach CP47 Arabidopsis CP47
Molecular Weight~56 kDa~56 kDa
Chlorophyll Binding16 Chl a + 4 β-carotene 16 Chl a + 4 β-carotene
InteractionsPsbH, PsbT, PsbL PsbH, PsbT, PsbL

Functional Roles in PSII

  • Excitation Energy Transfer: Directly transfers energy to the reaction center (D1/D2) .

  • Oxygen Evolution: Indirectly supports the Mn₄Ca cluster via CP43 interactions .

  • Repair Cycle: Forms stable subcomplexes (e.g., "no reaction center" complex) during PSII disassembly to prevent photodamage .

Recombinant Production and Engineering

Recombinant CP47 is typically expressed in E. coli with His-tags for affinity purification. Key steps include:

  1. Cloning: psbB gene insertion into bacterial vectors.

  2. Expression: Induced protein synthesis under optimized conditions.

  3. Purification: Ni-NTA chromatography for His-tagged proteins .

Challenges in Plant Systems

  • Post-Translational Modifications: Chloroplast-targeted recombinant proteins require proper folding and pigment binding .

  • Stability: CP47 lacks intrinsic stability without PSII core subunits, necessitating co-purification with PsbH/PsbL .

Assembly Dynamics

CP47 binds to the D1/D2 reaction center early in PSII biogenesis, preceding CP43 incorporation . Mutations in psbB disrupt PSII core assembly, reducing oxygen evolution efficiency .

Spectroscopic Properties

Isolated CP47 exhibits distinct absorption and fluorescence signatures:

  • 77 K Fluorescence: Emission maxima at ~685 nm (Chl a) .

  • Energy Transfer: Lifetime of ~4.6 ns in the absence of reaction centers .

Stress Response

Under high-light stress, CP47 forms "no reaction center" complexes (NRCs) to protect PSII during repair . These complexes lack D1/D2 but retain CP47, CP43, and associated low-molecular-weight subunits .

Limitations and Future Directions

While recombinant CP47 has been studied in spinach and cyanobacteria, no direct data exists for S. lycopersicum. Key gaps include:

  1. Species-Specific Modifications: Potential differences in pigment stoichiometry or subunit interactions.

  2. Agricultural Applications: Engineering CP47 to enhance PSII efficiency in tomatoes for improved crop yields.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP production.

Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 in Photosystem II?

CP47 functions as a core antenna protein in Photosystem II (PSII), binding chlorophyll molecules that gather light energy and transfer it to the reaction center. Structurally, CP47 is an integral membrane protein with multiple transmembrane helices that coordinate chlorophyll a molecules.

The protein plays several critical roles:

  • Serves as a core light-harvesting antenna

  • Maintains structural integrity of the PSII complex

  • Facilitates energy transfer from peripheral antenna complexes to the reaction center

  • Contains binding sites for approximately 16 chlorophyll a molecules and several β-carotene molecules

Recent structural studies have shown that CP47 interacts closely with the D1 and D2 proteins at the core of PSII, and its proper assembly is essential for functional photosynthesis .

What techniques are most effective for studying the chlorophyll-binding properties of recombinant CP47?

Several complementary techniques provide insights into the chlorophyll-binding properties of CP47:

  • Absorption spectroscopy: Characterizes the absorbance profile of bound chlorophylls (peaks at ~435 and ~670-680 nm)

  • Fluorescence spectroscopy: Reveals energy transfer dynamics between chlorophyll molecules

  • Circular dichroism: Provides information about pigment organization and protein secondary structure

  • Resonance Raman spectroscopy: Identifies specific chlorophyll-protein interactions

  • Non-resonant hole burning (HB) spectroscopy: Particularly valuable for identifying the lowest energy states and excitonic interactions

Studies using these techniques have revealed that the lowest energy states in CP47 are critically important for directing energy flow toward the reaction center. Recent research has revised previous structural assignments of chlorophylls contributing to the lowest excitonic states in CP47, suggesting that Chl 523 most strongly contributes to the lowest excitonic state, while Chl 526 contributes to the second excitonic state .

What expression systems yield functional recombinant CP47 protein?

Producing functional recombinant CP47 presents significant challenges due to its complex membrane protein nature and requirements for cofactor binding. Several expression systems have been explored:

Expression SystemAdvantagesLimitationsYieldFunctionality
E. coliWell-established protocols, rapid growthLacks chlorophyll synthesis machinery0.5-2 mg/LRequires reconstitution with pigments
CyanobacteriaNatural photosynthetic machineryGenetic manipulation more complex0.2-1 mg/LHigher native-like functionality
Plant chloroplastsNatural environment for foldingTechnical challenges in isolationVariableMost native-like properties
Cell-free systemsControl over reconstitutionLower yields, expensive0.1-0.5 mg/LVaries with reconstitution

For S. tuberosum CP47, recombinant expression in E. coli with an N-terminal His-tag has been documented, though special considerations for membrane protein expression and purification are necessary . The resulting protein requires careful handling to maintain stability, with storage in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

How can researchers optimize chlorophyll incorporation into recombinant CP47?

Successful reconstitution of chlorophyll into recombinant CP47 is crucial for obtaining a functional protein. Research suggests several approaches:

  • In vitro reconstitution: Purified recombinant CP47 apoprotein can be reconstituted with chlorophyll a using detergent micelles or liposomes. The reconstitution efficiency depends on:

    • Chlorophyll:protein ratio (optimal range: 10-20:1)

    • Detergent type and concentration

    • Temperature and incubation time

    • Presence of lipids

  • Co-expression with chlorophyll biosynthetic machinery: Some expression systems can be engineered to produce chlorophyll simultaneously with the protein.

  • Stabilization approaches: Studies have shown that both chlorophyll a and zinc-pheophytin a can stabilize CP47 against proteolytic degradation, with zinc-pheophytin a being superior in terms of the concentration required for equal yield of stabilized protein .

Experimental data indicates that stabilization of CP47 apoprotein is optimal after de novo synthesis of 90-300 pmol of Zn-pheophytin a or about 400-600 pmol of chlorophyll a per 4.2 × 10⁷ etioplasts . Interestingly, the yield of stabilized chlorophyll proteins decreases at higher concentrations of Zn-pheophytin a but is unaffected by higher concentrations of chlorophyll a .

What are the critical factors for maintaining stability of purified recombinant CP47?

Maintaining the stability of recombinant CP47 after purification requires attention to several factors:

  • Buffer composition:

    • Tris/PBS-based buffers with 6% trehalose at pH 8.0 have been shown to be effective

    • Addition of glycerol (5-50% final concentration) for long-term storage

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles, which significantly reduce protein stability

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Brief centrifugation prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Detergent considerations:

    • Maintain detergent above critical micelle concentration

    • Gentle detergents like DDM or digitonin preserve protein-pigment interactions better than harsher detergents

The presence of bound chlorophyll or similar molecules significantly enhances CP47 stability, consistent with findings that chlorophyll binding prevents proteolytic degradation of the apoprotein .

How do researchers determine the excitonic structure of CP47?

Determining the excitonic structure of CP47 requires sophisticated spectroscopic approaches and theoretical modeling:

  • Experimental methods:

    • Steady-state absorption spectroscopy

    • Fluorescence emission spectroscopy

    • Non-resonant hole burning (HB) spectroscopy

    • Linear dichroism (LD) measurements

    • Time-resolved fluorescence and transient absorption

  • Computational approaches:

    • Excitonic calculations based on crystal structure coordinates

    • Site energy assignments for individual chlorophylls

    • Modeling of excitonic interactions between chlorophylls

Recent research has revealed that fits of linear optical spectra together with hole burning (HB) spectra provide more realistic site energies than fits of absorption and emission spectra alone . This approach has led to revised structural assignments, indicating that Chl 523 most strongly contributes to the lowest excitonic state, with Chl 526 contributing to the second excitonic state .

Key spectroscopic parameters determined for CP47 include:

  • Lowest energy absorption bands at ~690-695 nm

  • Red-shifted emission maximum at ~695 nm

  • Oscillator strength of the lowest-energy state approximately ≤0.5 Chl equivalents

What experimental approaches can determine how CP47 interacts with other PSII components?

Several complementary approaches reveal CP47's interactions with other PSII components:

  • Biochemical methods:

    • Co-immunoprecipitation with antibodies against specific PSII subunits

    • Cross-linking followed by mass spectrometry

    • Pull-down assays using tagged recombinant proteins

    • Blue native gel electrophoresis of partially assembled complexes

  • Biophysical methods:

    • FRET analysis between labeled components

    • Surface plasmon resonance

    • Isothermal titration calorimetry

  • Structural methods:

    • X-ray crystallography of PSII complexes

    • Cryo-electron microscopy

    • NMR of specific interaction domains

Research has elucidated the assembly pathway of PSII, showing that after maturation of the D1 protein, an "RC47 subcomplex" forms by binding of CP47 and rapid addition of PsbH, PsbR, and PsbTc. Finally, CP43, PsbK, and PsbZ bind to complete the PSII reaction center . This sequential assembly process highlights the critical role of CP47 in the structural organization of PSII.

How does high-light stress affect CP47 stability and function?

High-light stress significantly impacts CP47 stability and function, with important implications for photosystem II performance:

  • Degradation patterns:

    • High light induces degradation of PSII subunits including CP47, CP43, PsbP, and PsbR

    • Damage typically follows a sequence, with D1 and D2 proteins damaged and replaced most frequently, while CP43 and CP47 are usually more long-lived

  • Repair mechanisms:

    • Damage leads to partial disassembly of PSII

    • Replacement of damaged subunits with nascent copies

    • Reassembly of PSII in an intricate process known as the PSII repair cycle

  • Species-specific responses:

    • Research comparing normal green-leaf tea cultivars with light-sensitive albino variants shows that high-light-induced degradation of PSII components, including CP47, varies significantly between phenotypes

    • The PSII complex in sensitive varieties shows greater vulnerability to high-light stress

These findings emphasize the importance of CP47 stability for maintaining photosynthetic performance under varying light conditions and suggest that recombinant CP47 systems could be valuable tools for studying photoprotection mechanisms.

How can recombinant CP47 be used to study energy transfer mechanisms in photosynthesis?

Recombinant CP47 provides a powerful experimental system for investigating fundamental energy transfer mechanisms:

  • Site-directed mutagenesis approaches:

    • Mutating specific chlorophyll-binding residues

    • Altering amino acids involved in protein-protein interactions

    • Creating chimeric proteins with domains from different species

  • Reconstitution with modified chlorophylls:

    • Using chlorophyll analogs with altered spectral properties

    • Incorporating specific isotope-labeled chlorophylls for spectroscopic studies

    • Testing the effects of different chlorophyll:protein ratios

  • Time-resolved spectroscopy applications:

    • Measuring energy transfer rates between specific chlorophyll molecules

    • Determining quantum yields of energy transfer

    • Identifying rate-limiting steps in the energy transfer cascade

Research using these approaches has demonstrated that the lowest electronic states of CP47 are critical for directing energy flow toward the reaction center. The excitonic structure of these states determines the efficiency of energy transfer, with the specific arrangement of chlorophylls in the protein scaffold playing a decisive role .

What comparative genomic approaches reveal functional conservation of CP47 across plant species?

Comparative genomic analysis of CP47 across plant species provides insights into evolutionary conservation and functional importance:

  • Sequence conservation analysis:

    • Identification of highly conserved regions corresponding to chlorophyll-binding sites

    • Detection of variable regions that may confer species-specific adaptations

    • Correlation between conservation and functional importance

  • Recombination studies:

    • Analysis of homeologous recombination rates between related species

    • Studies using introgression lines containing chromosome segments from different species

Research on homeologous recombination in Solanum species has shown that recombination rates within homeologous segments can be reduced to as little as 0-10% of expected frequencies . These rates are positively correlated with the length of introgressed segments, with the highest recombination (up to 40-50% of normal) observed in long introgressions or substitution lines .

Interestingly, crossing introgression lines to phylogenetically intermediate species increases homeologous recombination, with recombination rates highest in regions of overlap between segments from different species . These findings have important implications for breeding programs utilizing wild relatives as sources of genetic diversity.

What methodological challenges exist in correlating in vitro studies of recombinant CP47 with in vivo function?

Translating findings from recombinant protein studies to in vivo function presents several methodological challenges:

  • Structural integrity verification:

    • Confirming proper folding of recombinant CP47

    • Verifying correct chlorophyll binding stoichiometry and geometry

    • Assessing oligomeric state and protein-protein interactions

  • Functional equivalence testing:

    • Comparing spectroscopic properties with those of native CP47

    • Measuring energy transfer efficiencies

    • Testing stability under various conditions

  • Integration approaches:

    • Complementation studies in CP47-deficient mutants

    • Reconstitution of recombinant CP47 into PSII subcomplexes

    • Development of artificial membrane systems mimicking thylakoid environment

One significant challenge is reproducing the complex lipid environment of the thylakoid membrane, which affects protein folding, stability, and function. Additionally, the assembly of CP47 into PSII follows a specific pathway in vivo, with D1 maturation playing a key role in PSII assembly and affecting the incorporation of CP43 during formation of the PSII-LHCII supercomplex .

Research comparing in vitro and in vivo systems suggests that reconstitution with pigments is a critical step for obtaining functionally relevant recombinant CP47, with stabilization against proteolytic degradation being highly dependent on the concentration of chlorophyll a or zinc-pheophytin a .

How might synthetic biology approaches enhance recombinant CP47 production and functionality?

Synthetic biology offers promising avenues for improving recombinant CP47 production:

  • Codon optimization strategies:

    • Customizing codon usage for specific expression systems

    • Balancing mRNA secondary structure and translation efficiency

    • Engineering genetic elements for improved expression

  • Directed evolution approaches:

    • Developing high-throughput screening methods for CP47 functionality

    • Selecting variants with improved stability or assembly properties

    • Evolving CP47 with novel spectral properties

  • Scaffold protein engineering:

    • Designing fusion proteins to facilitate assembly

    • Creating protein tags that enhance stability while maintaining function

    • Developing self-assembling systems that incorporate CP47 with other PSII components

Future research may focus on developing "minimal photosystems" containing only essential components, which could provide clean experimental systems for studying energy transfer mechanisms and serve as building blocks for artificial photosynthetic devices.

What emerging techniques show promise for studying recombinant CP47 structure-function relationships?

Several cutting-edge techniques are expanding our ability to study CP47 structure-function relationships:

  • Single-molecule spectroscopy:

    • Revealing heterogeneity masked in ensemble measurements

    • Tracking energy transfer pathways in individual complexes

    • Observing conformational dynamics in real-time

  • Advanced imaging techniques:

    • Super-resolution microscopy of labeled CP47 in membranes

    • Atomic force microscopy of reconstituted complexes

    • Cryo-electron tomography of membrane-embedded proteins

  • Computational methods:

    • Molecular dynamics simulations of CP47 in membrane environments

    • Quantum mechanical calculations of excited state properties

    • Machine learning approaches for predicting structure-function relationships

These emerging techniques promise to provide unprecedented insights into the dynamic behavior of CP47 and its interactions with other photosynthetic components, potentially leading to new strategies for engineering improved photosynthetic efficiency in crops or bio-inspired solar energy conversion systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.