Recombinant Solanum lycopersicum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us to prioritize its incorporation.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient essential for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what role does it play in photosynthesis?

The psbA gene encodes the QB protein of photosystem II, which is essential for oxygenic photosynthetic electron transport. This protein plays a critical role in the light-dependent reactions of photosynthesis, specifically in the electron transfer pathway. The QB protein functions as the secondary electron acceptor in photosystem II, facilitating the movement of electrons from QA to the plastoquinone pool. This process is fundamental to the generation of chemical energy during photosynthesis. The protein is also notably the binding target for several classes of herbicides that inhibit photosynthesis .

How many psbA genes are typically present in photosynthetic organisms, and how does this vary across species?

The number of psbA genes varies significantly across photosynthetic organisms. For instance, the cyanobacterium Anacystis nidulans R2 contains three distinct psbA genes within its genome, each contributing to the production of the QB protein. Despite encoding the same functional protein, these genes can show differences in their expression levels and regulation patterns . In contrast, other photosynthetic organisms may contain only a single psbA gene or different numbers of gene copies. This variation has important implications for evolutionary studies, functional redundancy, and the organism's response to environmental stresses. The diversity in gene copy number also presents interesting research opportunities for understanding gene expression regulation in photosynthetic systems.

What techniques are commonly used to isolate and identify psbA genes from Solanum lycopersicum?

Researchers typically employ a combination of molecular biology techniques to isolate and identify psbA genes from tomato. The process generally begins with genomic DNA extraction from leaf tissue, followed by PCR amplification using primers designed to target conserved regions of the psbA gene. For more comprehensive studies, whole-genome sequencing approaches can be used, as seen in the characterization of Solanum species, where over 12 million genetic variants were identified through whole-genome resequencing .

After initial isolation, verification methods include restriction enzyme digestion patterns, Sanger sequencing, and comparison with reference sequences. Southern blotting can be used to determine gene copy number, while northern blotting or quantitative RT-PCR helps quantify expression levels. For functional verification, complementation studies in mutant lines lacking functional psbA can confirm the activity of the isolated gene.

How do environmental factors affect psbA gene expression in tomato plants?

Environmental factors significantly influence psbA gene expression in tomato plants, with light intensity and temperature being particularly important regulators. Under sub-high temperature and high light intensity conditions (35°C, 1000 μmol⋅m-2⋅s-1), photosystem II can experience irreversible inhibition, directly impacting the function of the psbA-encoded protein . These stress conditions can trigger complex regulatory responses in psbA expression patterns.

Temperature fluctuations often lead to modified expression levels as the plant attempts to maintain photosynthetic efficiency while avoiding photooxidative damage. Similarly, light quality and intensity directly modulate psbA transcription rates, as the gene product is central to light harvesting. Water availability, nutrient status, and pathogen presence also influence expression patterns through stress-response pathways. These environmental interactions make psbA an important subject for studies on plant adaptation and stress tolerance mechanisms in agricultural settings.

What strategies exist for targeted mutagenesis of the psbA gene in Solanum lycopersicum, and how do they compare in efficiency?

Several targeted mutagenesis approaches have been developed for modifying the psbA gene in photosynthetic organisms, with varying efficiencies when applied to Solanum lycopersicum. Building on techniques established for Chlamydomonas reinhardtii, researchers have implemented homologous recombination-based methods for introducing specific mutations into the plastidial psbA gene. This approach proved efficient even without direct positive selection, representing a significant advancement in targeted gene editing .

For comparison, contemporary techniques include:

Mutagenesis TechniqueEfficiency in TomatoTechnical ComplexitySelection RequirementsAdvantages
Homologous RecombinationModerate (10-30%)HighCan work without direct positive selectionPrecise editing
CRISPR-Cas9High (40-70%)ModerateRequires screeningMultiplexed editing possible
TALEN-based editingModerate (20-40%)HighRequires selection markersHigh specificity
Base editingVariable (15-50%)ModerateSimplified screeningNo double-strand breaks
Prime editingEmerging in tomatoHighMinimal selection requiredPrecise insertions/deletions

Efficiency varies depending on the specific genetic background, transformation method, and tissue culture conditions. When selecting a mutagenesis approach, researchers must consider not only efficiency but also the nature of the desired mutation, available resources, and regulatory considerations for the resulting plants .

What are the most effective expression systems for producing recombinant Solanum lycopersicum psbA protein for structural and functional studies?

The expression of functional recombinant psbA protein presents significant challenges due to its membrane-embedded nature and involvement in complex protein-cofactor interactions. Based on current research approaches, several expression systems show promise:

Expression SystemAdvantagesLimitationsYieldFunctional Activity
Cyanobacterial hostsNative-like membrane environment, natural cofactor assemblySpecies-specific optimization requiredModerateHigh
Chlamydomonas reinhardtiiEukaryotic processing, chloroplast transformation establishedComplex transformation processVariableHigh
E. coli with membrane-targetingHigh biomass, rapid growthOften forms inclusion bodies, lacks cofactorsHighLimited
Cell-free systemsAvoids toxicity issues, allows toxic protein expressionExpensive, requires optimizationLow-moderateVariable
Transplastomic tobaccoPlant-based system, high expressionTime-consuming developmentHighHigh

For structural studies requiring large protein quantities, bacterial systems with optimization for membrane protein expression offer advantages in yield, while functional studies benefit from photosynthetic hosts like cyanobacteria or Chlamydomonas where proper folding and cofactor assembly occur. The choice depends on research objectives, with hybrid approaches often providing complementary advantages .

How can modifications to the QA binding site in Photosystem II be optimized to enhance electron transfer to exogenous quinones?

Optimizing modifications to the QA binding site requires strategic structural alterations that enhance exogenous quinone reduction without compromising photosystem stability. Research demonstrates that shortening the distance between QA and exogenous quinones significantly increases their reduction rate, creating potential pathways for redirecting photosynthetic electron flow .

Several optimization strategies have shown promise:

  • Structural modifications: Targeted mutations based on computational modeling can reshape the binding pocket to better accommodate exogenous quinones while maintaining essential protein-cofactor interactions. These modifications can be guided by molecular dynamics simulations that predict optimal binding configurations .

  • C-terminal truncations: Truncating specific subunit C-termini that protrude into the stroma has been shown to effectively reduce the distance between QA and exogenous quinones. In Chlamydomonas reinhardtii, truncating the PsbT subunit C-terminus led to sustained electron transfer to 2,6-dimethyl-p-benzoquinone (DMBQ), effectively bypassing the natural QA to QB pathway .

  • Quinone selection optimization: The choice of exogenous quinone significantly affects electron transfer rates. Structure-activity relationship studies can identify quinone derivatives with optimal redox properties and binding characteristics for specific modified QA sites .

  • Combined approaches: Integrating site-directed mutagenesis with quinone derivative screening and electrochemical analysis provides comprehensive optimization, as confirmed by chronoamperometry measurements showing sustained electron transfer to exogenous acceptors .

These optimizations have significant implications for both fundamental photosynthesis research and applications in biophotovoltaics, where extracting electrons from photosystems for electrical power generation remains limited by kinetic constraints .

What are the evolutionary implications of psbA gene diversity across Solanum species, and how does this inform breeding strategies?

The evolutionary diversity of psbA genes across Solanum species provides critical insights into adaptation mechanisms and offers valuable resources for tomato improvement strategies. Wild species like Solanum pimpinellifolium (SP) and weedy forms like S. lycopersicum var. cerasiforme (SLC) represent largely untapped genetic reservoirs that are fully cross-compatible with cultivated tomato .

Whole-genome resequencing of diverse Solanum accessions has revealed remarkable genetic variation, with SP accessions containing 3.1 to 4.8 million variants and SLC accessions containing 1.2 to 1.9 million variants. Notably, 46.3% of these variants (4,897,803) are private variants unique to specific accessions, highlighting the substantial genetic diversity available .

The evolutionary analysis of these variants shows:

  • SP demonstrates high diversity likely associated with adaptation to different environments, while SLC variation reflects both environmental adaptation and human selection pressures .

  • Complex evolutionary history is evident in SLC, including potential footprints of common ancestors or ancient introgressions between taxa .

  • Functional characterization of variants reveals significant enrichment of terms related to cell wall changes that appear to have been negatively selected during domestication and breeding .

These findings suggest breeding strategies should prioritize:

  • Introgression of beneficial psbA variants from wild species using approaches that overcome recombination barriers

  • Utilization of multi-parent advanced generation inter-cross (MAGIC) populations to capture diverse allelic combinations

  • Development of marker-assisted selection tools targeting specific psbA variants associated with stress tolerance

Such strategies can effectively exploit the evolutionary diversity of psbA genes to improve photosynthetic efficiency, stress tolerance, and yield stability in tomato varieties .

What are the key considerations when designing experiments to study psbA gene function in tomato using introgression lines?

When designing experiments using introgression lines to study psbA function in tomato, researchers must address several critical factors to ensure meaningful results:

  • Selection of appropriate introgression lines: Choose lines containing targeted Solanum lycopersicoides chromosome segments in the cultivated tomato background. Consider segment length, as longer introgressions (or whole-chromosome substitution lines) demonstrate higher recombination rates (up to 40-50% of normal), facilitating genetic analysis .

  • Experimental controls: Include the recurrent parent (cultivated tomato) and donor parent (wild species) alongside introgression lines to distinguish background effects from introgression-specific phenotypes. Additionally, incorporate multiple independent introgression lines covering the same chromosomal region to confirm observed effects .

  • Phenotypic characterization strategy: Implement comprehensive phenotyping approaches using standardized descriptors for plant, inflorescence, fruit, and agronomic traits. This should include photosynthetic measurements (fluorescence, gas exchange, electron transport rates) directly relevant to psbA function .

  • Environmental variables: Control environmental conditions meticulously, as psbA expression and function are highly sensitive to temperature and light intensity. Consider incorporating controlled stress treatments (e.g., 35°C, 1000 μmol⋅m-2⋅s-1) to evaluate stress responses .

  • Molecular verification: Confirm introgression boundaries through molecular markers or sequencing to precisely define the genetic composition of each line, enabling accurate association of phenotypes with specific genomic regions .

  • Statistical design: Implement randomized complete block designs with sufficient replication (minimum n=6) to account for environmental variation and provide adequate statistical power for detecting potentially subtle effects on photosynthetic parameters.

How can researchers troubleshoot common issues in psbA gene mutation and expression studies?

Researchers working with psbA gene mutations and expression often encounter several technical challenges. The following troubleshooting approaches address common issues:

IssuePossible CausesTroubleshooting Approaches
Low transformation efficiencySuboptimal protocol, tissue sensitivityOptimize DNA concentration (50-100 ng/μL), adjust selection timing, use younger tissue, modify hormone concentrations
No detectable psbA expressionImproper construct design, RNA degradationVerify promoter functionality, check for RNA quality (RIN > 7), use multiple reference genes for normalization
Non-specific amplification in PCRPrimer design issues, contaminationRedesign primers with higher specificity, optimize annealing temperature, perform gradient PCR, use touchdown protocols
Lethal mutations in psbADisruption of essential functionUse inducible expression systems, create heteroplasmic tissues, complement with alternative electron transport pathways
Phenotype not matching expected mutation effectsBackground mutations, epigenetic effectsBackcross to wild type, analyze multiple independent transgenic lines, perform whole-genome sequencing to identify off-target effects
Inconsistent photosynthetic measurementsEnvironmental variability, measurement timingStandardize measurement conditions (light, temperature, CO2), measure at consistent times, increase biological replicates
Poor protein solubilityMembrane protein extraction challengesTry detergent screening (DDM, LDAO, SDS), optimize buffer conditions (pH 6.0-8.0), use mild solubilization methods

When targeting mutations to the plastidial psbA gene, researchers should consider adopting strategies derived from efficient homologous-recombination-based methodologies that have proven effective even without direct positive selection . For expression analysis, normalizing transcript levels against multiple reference genes and performing measurements at standardized developmental stages helps ensure reproducible results.

What analytical techniques provide the most comprehensive assessment of recombinant psbA protein function?

A comprehensive assessment of recombinant psbA protein function requires multiple complementary analytical approaches that evaluate different aspects of protein activity and integration:

  • Electron transport measurements: Oxygen evolution and chlorophyll fluorescence analyses provide direct functional assessment of PSII activity. Specific techniques include:

    • Pulse-amplitude modulation (PAM) fluorometry for PSII quantum yield (Fv/Fm) and electron transport rate

    • Oxygen electrode measurements of light-dependent O2 evolution

    • P700 absorbance changes to assess downstream electron transport

  • Binding studies: Characterizing herbicide and quinone binding properties:

    • Isothermal titration calorimetry (ITC) for binding affinities

    • Surface plasmon resonance (SPR) for binding kinetics

    • Radioligand binding assays with tritiated herbicides

    • Competition assays with various quinones and inhibitors

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy for secondary structure assessment

    • Cryo-electron microscopy for structural determination

    • Mass spectrometry for post-translational modifications

  • Electrochemical techniques:

    • Chronoamperometry to measure sustained electron transfer to exogenous quinones. This technique has successfully demonstrated that shortening the distance between QA and exogenous quinones like DMBQ leads to enhanced electron transfer rates and sustained current generation .

    • Cyclic voltammetry to determine redox properties

  • In vivo functional complementation:

    • Phenotypic rescue of psbA-deficient mutants

    • Growth and photosynthetic performance under various stress conditions

    • Herbicide resistance profiling

These combined approaches provide a comprehensive functional profile of recombinant psbA proteins, especially when examining modifications designed to alter electron transport pathways or quinone interactions .

How might CRISPR-Cas9 technology advance psbA gene modification strategies beyond traditional approaches?

CRISPR-Cas9 technology offers transformative potential for psbA gene modification through several advanced applications that surpass traditional methods:

  • Precise chloroplast genome editing: While challenging due to multiple chloroplast genome copies, CRISPR-Cas9 systems specifically designed for chloroplast targeting can achieve precise edits directly in the organellar genome. This overcomes limitations of traditional chloroplast transformation methods that rely on homologous recombination with lower efficiency and specificity.

  • Multiplexed editing: CRISPR systems enable simultaneous modification of multiple sites within the psbA gene or concurrent editing of psbA and interacting genes, allowing comprehensive pathway engineering impossible with traditional approaches. This facilitates exploration of complex electron transport chain modifications.

  • Base editing applications: CRISPR base editors can introduce specific nucleotide changes without creating double-strand breaks, enabling subtle modifications that maintain photosynthetic function while altering specific properties like herbicide binding or electron transfer kinetics. This precision is particularly valuable for modifying the QA binding site to enhance electron transfer to exogenous quinones .

  • Regulatory element engineering: Beyond coding sequence modifications, CRISPR technology enables precise editing of psbA promoters and regulatory elements to modulate expression under specific environmental conditions or developmental stages.

  • High-throughput variant screening: CRISPR libraries targeting different psbA regions can generate comprehensive variant collections for functional screening, accelerating discovery of beneficial mutations for stress tolerance or enhanced photosynthetic efficiency.

These approaches complement existing targeted mutagenesis strategies while offering unprecedented precision, efficiency, and throughput for advancing our understanding of psbA function and developing improved photosynthetic systems .

What potential applications exist for engineered psbA variants in improving crop photosynthetic efficiency under changing climate conditions?

Engineered psbA variants offer promising applications for enhancing crop photosynthetic efficiency under increasingly challenging climate conditions:

  • Temperature stress tolerance: Modified psbA proteins with enhanced thermostability can maintain photosynthetic efficiency under rising temperatures. By engineering variants that preserve PSII function at high temperatures (35°C+), crops can avoid the irreversible photoinhibition observed under combined heat and high light conditions . This approach is particularly relevant as global temperatures continue to rise.

  • Photoprotection enhancement: Engineered psbA variants that optimize electron flow under fluctuating light conditions can reduce photodamage while maintaining productivity. These variants could enhance non-photochemical quenching or alternative electron dissipation pathways, protecting photosynthetic machinery during sudden light intensity changes common in field conditions.

  • Water-use efficiency improvement: Variants with altered QB binding properties could potentially influence stomatal responses and water vapor exchange, improving water-use efficiency under drought conditions. This application connects photosynthetic electron transport modifications to whole-plant water relations.

  • Electron flow redirection: Building on research demonstrating successful redirection of electron flow to exogenous quinones , engineered psbA variants could channel excess electrons to alternative metabolic pathways during stress, preventing reactive oxygen species formation while maintaining energy production.

  • Photosynthetic adaptation to elevated CO2: As atmospheric CO2 levels rise, optimized psbA variants could better balance electron transport with carbon fixation rates, preventing limitations in the electron transport chain from restricting photosynthetic gains under elevated CO2.

These applications represent frontier opportunities for crop improvement through precise engineering of a central component of the photosynthetic apparatus, potentially contributing to climate-resilient agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.