Recombinant Solanum lycopersicum Protein ASC1 (Asc-1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Protein Structure:

  • Length: 308 amino acids (full-length variant) .

  • Gene: Encoded by the Asc1 gene (UniProt ID: Q9M6A3), which spans six exons and is critical for ceramide biosynthesis .

Expression Systems:

  • Produced in E. coli with an N-terminal His-tag for purification .

  • Purity: ≥85–90% (verified by SDS-PAGE) .

Functional Roles

Disease Resistance:

  • Confers resistance to Alternaria alternata f. sp. lycopersici (AAL-toxin) by maintaining sphingolipid homeostasis. Mutations in Asc1 disrupt ceramide synthesis, leading to toxin-induced apoptosis .

  • Key Mechanism: Prevents accumulation of toxic sphingolipid intermediates (e.g., dihydrosphingosine) during AAL-toxin exposure .

Mutations Linked to Susceptibility:

MutationEffect on ProteinPhenotypeSource
nt 854_855delFrameshift, premature stop codonAAL-toxin susceptibility
nt 931_932insTFrameshift, truncated protein (97 aa)AAL-toxin susceptibility
Multiple missenseNo impact on susceptibility (neutral)Retained resistance

Research Applications

Key Studies:

  1. AAL-Toxin Resistance:

    • Recombinant ASC1 restored sphingolipid synthesis in yeast (lag1Δlac1Δ mutants), confirming functional conservation .

    • In tomato, ASC1 deficiency led to 60–80% reduction in ceramide levels under toxin exposure .

  2. Domestication and Mutation Spread:

    • Susceptibility-linked Asc1 mutations (e.g., nt 854_855del) were identified in ancestral tomato lineages (S. pimpinellifolium, S. lycopersicum var. cerasiforme), suggesting historical gene flow .

  3. Mitochondrial Health:

    • Indirect evidence links ASC1 to mitochondrial translation efficiency in yeast homologs, though this requires validation in plants .

Current Challenges and Future Directions

  • Functional Redundancy: Some Asc1 missense mutations do not alter susceptibility, implying backup pathways in sphingolipid metabolism .

  • Biotechnological Potential: Engineering Asc1 variants could enhance disease resistance in commercial tomato cultivars without compromising yield.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Asc-1; Alternaria stem canker resistance protein 1; Protein ASC1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
Asc-1
Target Protein Sequence
MKNLDHIAASVDWEKESLPEYQDLIFLLFFALFFPVLRFILDRFVFEALAKRMIFGKKTV VNINGREERKKINKFKESAWKFVYFLSAELLALSVTCNEPWFTDSRYFWAGPGDVVWPNL KMKLKLKLLYMYAGGFYFYSIFATLYWETRRYDFAAQIIHHVTTVSLIVLSYVYGFARIG SVVLALHDGSDVFMEIAKMSKYSGFDLIADIFFSLFALVFTSLRIICYPFWIIRSTCYEL LYVLDIQKERTTGIILYFVFNALLICLLVLHLFWFKIILRMVKNQILSRGHITDDVREDS ESDDDHKD
Uniprot No.

Target Background

Function

Mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring sphingolipid biosynthesis. It can also rescue the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in ceramides-depleted cells following SAM exposure.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Asc1 protein and what is its primary function in Solanum lycopersicum?

The Asc1 (alternaria stem canker resistance protein 1) gene encodes an enzyme involved in ceramide biosynthesis in tomato (Solanum lycopersicum var. lycopersicum, SLL). The primary function of this protein is to confer resistance against stem canker disease caused by Alternaria alternata f. sp. lycopersici and its pathogenic factor AAL-toxin . Specifically, Asc1 enables the production of ceramide that protects tomato tissues from the apoptotic cell death induced by AAL-toxin . Functional Asc1 protein is therefore essential for maintaining disease resistance in tomato cultivars.

How does the Asc1 gene influence disease resistance in tomatoes?

The Asc1 gene influences disease resistance through its ceramide biosynthesis pathway. When functional, the Asc1 protein produces ceramide compounds that protect tomato tissues from the cell death mechanisms triggered by AAL-toxin . In susceptible cultivars, mutations in the Asc1 gene result in either a non-functional or truncated protein that cannot effectively synthesize protective ceramides, leading to AAL-toxin sensitivity and subsequent disease development . This relationship between Asc1 functionality and disease resistance represents a clear gene-for-gene interaction in the tomato-Alternaria pathosystem.

What are the evolutionary implications of Asc1 gene variations across wild and domesticated tomato species?

The variations in the Asc1 gene across wild and domesticated tomato species provide important insights into tomato evolution and domestication. Studies have shown that Solanum lycopersicum var. cerasiforme (SLC) is considered the ancestor of cultivated tomato (SLL), while jitomate criollo (SLJ) represents an intermediate form between SLC and SLL . The presence of both functional and mutated Asc1 alleles across these species suggests that these genetic variations were inherited throughout the history of tomato domestication and breeding . Interestingly, since the stem canker pathogen has not been reported in South America, susceptibility/resistance to Alternaria alternata or AAL-toxin may not have been a selective factor in the evolution of Asc1 mutations in wild populations .

What is the molecular structure of the Asc1 protein and how does it relate to its function?

The Asc1 protein functions as an enzyme in the ceramide biosynthesis pathway. Based on current research, the protein's functional domains are critical for its enzymatic activity. When frameshift mutations occur, such as the two-nucleotide deletion (nt 854_855del) found in susceptible cultivars or the T-insertion (nt 931_932insT) identified in S. pimpinellifolium PER018805, the resulting protein structure is significantly altered . For instance, the T-insertion mutation in SP PER018805 results in a truncated 97 amino acid protein, which is likely non-functional compared to the complete wild-type protein . These structural alterations directly impact the protein's ability to catalyze ceramide production, thereby affecting disease resistance.

How do specific amino acid substitutions affect Asc1 protein functionality?

Research has identified eleven types of missense mutations in the Asc1 sequence across various tomato accessions (509A>G, 569A>C, 570G>A, 572A>G, 617G>A, 807T>C, 836A>T, 911G>A, 1010A>C, 1366T>C, 1693T>G) . Interestingly, these amino acid substitutions do not appear to affect susceptibility to AAL-toxin, suggesting that these particular changes do not critically disrupt the protein's functional domains or catalytic activity . This finding indicates that certain regions of the Asc1 protein are more tolerant of sequence variation, while others (such as those affected by frameshift mutations) are essential for maintaining proper protein function.

What techniques are most effective for expressing and purifying recombinant Asc1 protein for structural studies?

For expressing and purifying recombinant Asc1 protein, researchers typically employ a combination of molecular cloning techniques and heterologous expression systems. The process begins with the amplification of the full-length Asc1 gene from resistant tomato cultivars using high-fidelity PCR. The amplified gene is then cloned into an appropriate expression vector, often containing a histidine tag or other affinity tags for purification. Expression systems such as E. coli (BL21 or Rosetta strains), yeast (Pichia pastoris), or insect cells may be used depending on the requirement for post-translational modifications.

Following expression, the recombinant protein can be purified using affinity chromatography (e.g., Ni-NTA for His-tagged proteins), followed by size exclusion chromatography to ensure high purity. For structural studies, additional steps may include removal of affinity tags using specific proteases and concentration of the protein under conditions that maintain its native conformation. X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can then be employed to determine the protein's three-dimensional structure and relate it to its enzymatic function in ceramide biosynthesis.

What types of mutations have been identified in the Asc1 gene and how do they correlate with AAL-toxin susceptibility?

Several distinct mutations have been identified in the Asc1 gene that correlate with AAL-toxin susceptibility. The table below summarizes the key mutations and their effects:

Mutation TypeDescriptionTomato AccessionsEffect on ProteinAAL-toxin Susceptibility
Two-nucleotide deletionnt 854_855del in second exonSLC PER018894, SLJ M5-3, SLL cv. Aichi-firstFrameshift causing non-functional proteinSusceptible
T-insertionnt 931_932insT in second exonSP PER018805Frameshift resulting in smaller (97 aa) premature proteinSusceptible
~400 bp deletionIncludes 5′-UTR and part of 5′ ORFSC (LA 0437 and LA 0521), SG (LA 0438 and LA 0528)Absence of functional proteinSusceptible
Missense mutations11 types (509A>G, 569A>C, etc.)31 accessionsAmino acid substitutionsResistant (no effect)

These mutations demonstrate that frameshift mutations or large deletions that significantly alter the protein structure correlate with AAL-toxin susceptibility, while missense mutations generally do not affect resistance .

How can researchers identify and characterize novel Asc1 mutations in tomato breeding programs?

To identify and characterize novel Asc1 mutations in tomato breeding programs, researchers should implement a comprehensive methodology combining phenotypic screening, molecular analysis, and functional validation:

  • Phenotypic Screening: First, conduct bioassays using leaflets exposed to AAL-toxin. Susceptible plants will display characteristic veinal necrosis as observed in previous studies . This initial screen identifies potentially susceptible accessions.

  • PCR-based Detection: Design primers to amplify specific regions of the Asc1 gene. For example, use primer sets like F10/R10 to detect the presence of large deletions (~400 bp) in the Asc1 region .

  • DNA Sequencing: Sequence the entire Asc1 coding region from accessions showing susceptibility to identify specific mutations. Compare these sequences with reference sequences from resistant cultivars (e.g., Acc. #AF198177) .

  • Mutation Characterization: Analyze the mutations to determine their potential impact on protein structure and function. Frameshift mutations, insertions, or deletions that alter the reading frame are particularly important to note.

  • Functional Validation: Express the mutated Asc1 gene in a heterologous system or use gene editing tools to introduce the mutation into a resistant background to confirm its role in susceptibility.

  • Phylogenetic Analysis: Place any novel mutations in evolutionary context by comparing them with known Asc1 variations across different tomato species and cultivars.

This systematic approach ensures thorough characterization of novel Asc1 mutations and their potential impact on disease resistance in tomato breeding programs.

What is the relationship between Asc1 gene mutations and the evolutionary history of tomato domestication?

The distribution of Asc1 mutations across different tomato species provides insight into the evolutionary history of tomato domestication. Phylogenetic analysis based on COSII sequences has shown that AAL-toxin susceptible S. pimpinellifolium PER018805 is located in Clade S3 along with other SP accessions and SLC, while susceptible SLC PER018894 and SLJ M5-3 belong to Clade S2 together with SLL cultivars .

This phylogenetic arrangement suggests that Asc1 mutations have been inherited through the domestication process. As SLC is considered the ancestor of SLL, and SLJ represents an intermediate form between SLC and SLL, the presence of identical mutations (such as the two-nucleotide deletion) in both wild and cultivated varieties indicates that these genetic variations were passed down during domestication and subsequent breeding .

Interestingly, the absence of the stem canker pathogen in South America suggests that Asc1 mutations may have arisen and persisted without direct selection pressure related to disease resistance . This indicates that the mutations might have been maintained due to genetic drift or linkage with other selected traits during the domestication process, rather than as a result of pathogen-driven selection.

What are the most reliable methods for assessing AAL-toxin susceptibility in tomato accessions?

The most reliable method for assessing AAL-toxin susceptibility in tomato accessions is the leaflet bioassay. This approach has been effectively utilized in research studies and involves the following protocol:

  • Sample Collection: Harvest healthy leaflets from tomato plants at a similar developmental stage, typically from 4-6 week old plants.

  • Toxin Preparation: Prepare purified AAL-toxin solutions at appropriate concentrations (typically 0.2-1 μM).

  • Bioassay Setup: Place the detached leaflets in Petri dishes containing filter paper moistened with the AAL-toxin solution or water (as a control).

  • Incubation: Incubate the leaflets under controlled conditions (usually 25°C with a 16/8 h light/dark cycle) for 48-72 hours.

  • Symptom Evaluation: Assess and document symptoms. Susceptible accessions will display characteristic veinal necrosis, while resistant accessions will show no symptoms .

  • Quantification: Score the severity of symptoms using a standardized scale or measure the percentage of affected leaf area for quantitative analysis.

This method provides a clear phenotypic differentiation between susceptible and resistant accessions, as demonstrated in studies where accessions like S. lycopersicum var. lycopersicum "jitomate criollo" M5-3, S. lycopersicum var. cerasiforme PER018894, and S. pimpinellifolium PER018805 were identified as susceptible to AAL-toxin .

How can researchers effectively clone and express the Asc1 gene for functional studies?

For effective cloning and expression of the Asc1 gene for functional studies, researchers should follow this methodological approach:

  • Gene Amplification:

    • Design specific primers based on the known Asc1 sequence (reference: Acc. #AF198177).

    • Extract high-quality genomic DNA from resistant tomato cultivars.

    • Amplify the complete Asc1 gene using high-fidelity PCR enzymes to minimize error introduction.

  • Cloning Strategy:

    • Select an appropriate expression vector with a promoter suitable for the expression system.

    • Include a tag (His, FLAG, or GST) for purification and detection.

    • Design the construct to allow for proper protein folding and function.

  • Expression Systems:

    • For protein production: Use E. coli BL21(DE3) for high yield or eukaryotic systems like yeast or insect cells if post-translational modifications are required.

    • For functional complementation: Use Agrobacterium-mediated transformation to introduce the gene into susceptible tomato cultivars.

  • Functional Validation:

    • Express both wild-type and mutated versions of Asc1 to compare their functionality.

    • Assess protein function through in vitro ceramide synthesis assays.

    • Conduct complementation tests by transforming susceptible tomato lines with the functional Asc1 gene and challenging with AAL-toxin.

  • Protein Analysis:

    • Confirm protein expression using Western blotting with antibodies against the tag or Asc1 protein.

    • Assess protein localization using fluorescent protein fusions and confocal microscopy.

    • Characterize enzyme kinetics and substrate specificity for detailed functional understanding.

This comprehensive approach ensures proper gene isolation, expression, and functional characterization of the Asc1 protein for in-depth mechanistic studies.

What bioinformatic tools and databases are most useful for analyzing Asc1 sequence variations across tomato species?

For analyzing Asc1 sequence variations across tomato species, researchers should utilize a combination of specialized bioinformatic tools and databases:

  • Sequence Databases:

    • NCBI GenBank for reference sequences (e.g., Acc. #AF198177 for Asc1)

    • Sol Genomics Network (SGN) for tomato-specific genomic resources

    • Tomato Genetics Resource Center (TGRC) database for information on wild tomato accessions

  • Sequence Alignment Tools:

    • MUSCLE or MAFFT for multiple sequence alignment of Asc1 variants

    • Clustal Omega for visualizing conservation patterns across species

    • MEGA X for constructing and visualizing phylogenetic relationships

  • Variant Identification and Analysis:

    • BLAST for initial sequence comparisons

    • SnpEff for predicting the effects of mutations on protein function

    • PROVEAN or SIFT for assessing the functional impact of amino acid substitutions

  • Protein Structure Prediction:

    • AlphaFold or Swiss-Model for generating protein structure models

    • PyMOL or UCSF Chimera for visualizing the structural effects of mutations

    • ConSurf for mapping evolutionary conservation onto protein structures

  • Evolutionary Analysis:

    • PAML for detecting selection signatures in the Asc1 gene

    • BEAST for Bayesian evolutionary analysis

    • PopGenome in R for population genetics analyses

  • Visualization Tools:

    • IGV (Integrative Genomics Viewer) for visualizing sequence alignments

    • FigTree for displaying phylogenetic trees

    • R packages (e.g., ggplot2) for creating publication-quality graphics of sequence variation data

By utilizing these tools in combination, researchers can comprehensively analyze Asc1 sequence variations, predict their functional consequences, and understand their evolutionary significance across tomato species.

How should researchers approach conflicting data regarding Asc1 gene function and mutation effects?

When confronted with conflicting data regarding Asc1 gene function and mutation effects, researchers should implement a systematic approach to data reconciliation:

  • Critical Evaluation of Methodologies:

    • Compare experimental designs, including tomato accessions used, growth conditions, and AAL-toxin application methods.

    • Assess the sensitivity and specificity of phenotyping approaches used in different studies.

    • Evaluate molecular techniques for mutation identification (sequencing methods, coverage, quality controls).

  • Standardization and Replication:

    • Replicate key experiments using standardized protocols across multiple tomato accessions.

    • Implement blinded assessment of phenotypes to reduce observer bias.

    • Use multiple complementary techniques to confirm findings (e.g., both genetic and biochemical approaches).

  • Integration of Diverse Data Types:

    • Combine phenotypic, genetic, and molecular data to build a comprehensive understanding.

    • Utilize functional assays to directly test the effects of specific mutations on protein activity.

    • Consider environmental variables that might influence gene expression or protein function.

  • Contextual Analysis:

    • Consider the genetic background in which mutations occur, as other genes may modulate Asc1 effects.

    • Analyze the evolutionary context across tomato species to identify patterns in mutation distribution.

    • Investigate potential epistatic interactions with other genes in the ceramide biosynthesis pathway.

  • Meta-analysis Approaches:

    • Conduct formal meta-analyses when sufficient studies are available.

    • Weight evidence based on methodological rigor and sample size.

    • Identify patterns that emerge across multiple independent studies.

What statistical methods are most appropriate for analyzing the correlation between Asc1 mutations and disease susceptibility?

For analyzing the correlation between Asc1 mutations and disease susceptibility, researchers should employ a multi-faceted statistical approach:

  • Association Analysis:

    • Fisher's exact test or chi-square tests to assess the association between specific mutations and binary susceptibility outcomes.

    • Odds ratios with confidence intervals to quantify the strength of association between mutations and susceptibility.

    • Logistic regression for multivariate analysis when controlling for additional factors (e.g., genetic background, environmental conditions).

  • Phenotypic Data Analysis:

    • ANOVA or Kruskal-Wallis tests (depending on data distribution) to compare disease severity across different mutation types.

    • Mixed-effects models when incorporating random factors such as experimental blocks or replications.

    • Principal Component Analysis (PCA) when analyzing multiple disease-related traits simultaneously.

  • Genetic Analysis:

    • Segregation analysis in crosses between resistant and susceptible lines to confirm Mendelian inheritance patterns.

    • Linkage disequilibrium analysis to identify associations between Asc1 mutations and other genomic regions.

    • QTL mapping to identify potential modifier loci that interact with Asc1 to influence susceptibility.

  • Phylogenetic Methods:

    • Ancestral state reconstruction to infer the evolutionary history of Asc1 mutations.

    • Phylogenetically independent contrasts to account for relatedness when comparing susceptibility across species.

    • Bayesian approaches to model the probability of mutation events along phylogenetic branches.

  • Validation Techniques:

    • Cross-validation to assess the robustness of predictive models.

    • Permutation tests to establish significance thresholds while controlling for multiple testing.

    • Bootstrap methods to estimate confidence intervals for complex statistics.

This comprehensive statistical toolkit enables researchers to establish robust correlations between specific Asc1 mutations and disease susceptibility while accounting for the complexities of genetic data and phenotypic variation.

How can researchers effectively integrate genetic, biochemical, and phenotypic data in Asc1 studies?

Effective integration of genetic, biochemical, and phenotypic data in Asc1 studies requires a multi-omics approach:

  • Data Collection Coordination:

    • Design experiments to collect genetic, biochemical, and phenotypic data from the same samples when possible.

    • Establish consistent metadata recording across different data types to enable proper integration.

    • Implement standardized protocols for each data type to minimize technical variation.

  • Integration Platforms and Tools:

    • Utilize integrated database systems that can store and link diverse data types.

    • Employ multi-omics data integration tools such as mixOmics in R or MultiGrain.

    • Develop custom data pipelines that preserve relationships between different measurement types.

  • Analytical Approaches:

    • Correlation networks to identify relationships between genetic variations, ceramide metabolite levels, and disease symptoms.

    • Machine learning methods (e.g., random forests, support vector machines) to identify patterns across data types.

    • Causal modeling approaches like structural equation modeling to test hypothesized relationships between genetic, biochemical, and phenotypic variables.

  • Visualization Strategies:

    • Interactive visualization tools that allow exploration of relationships across data types.

    • Heat maps combining genetic mutations, metabolite levels, and phenotypic scores.

    • Pathway diagrams overlaid with multi-omics data to contextualize findings within ceramide biosynthesis pathways.

  • Validation Framework:

    • Transgenic complementation studies to confirm relationships between specific mutations and phenotypes.

    • In vitro enzyme assays to directly link genetic variations to biochemical function.

    • Metabolic profiling to connect genetic changes to alterations in ceramide pathway intermediates.

  • Data Interpretation Model:

    • Develop a hierarchical model linking genetic variations to protein function, to metabolite production, to cellular responses, and finally to whole-plant phenotypes.

    • Consider time-dependent changes by including temporal data collection when possible.

    • Account for environmental factors that may modulate the relationship between genotype and phenotype.

This integrated approach provides a comprehensive understanding of how Asc1 mutations affect protein function, ceramide biosynthesis, and ultimately disease susceptibility in tomato plants.

What are the current challenges in developing recombinant Asc1 protein for functional studies?

Several significant challenges exist in developing recombinant Asc1 protein for functional studies:

  • Protein Solubility and Stability:

    • Asc1 is involved in ceramide biosynthesis, suggesting it may interact with membranes, which can complicate expression in heterologous systems.

    • Maintaining proper protein folding during expression and purification is challenging, often requiring optimization of buffer conditions and stabilizing agents.

  • Post-translational Modifications:

    • If Asc1 requires specific post-translational modifications for activity, bacterial expression systems may be inadequate.

    • Identifying and characterizing these modifications requires sophisticated proteomics approaches and may necessitate eukaryotic expression systems.

  • Functional Assay Development:

    • Developing reliable in vitro assays for ceramide biosynthesis activity requires access to appropriate substrates and analytical methods.

    • Correlating in vitro enzyme activity with in vivo disease resistance phenotypes presents challenges in data interpretation.

  • Structural Characterization:

    • Obtaining sufficient quantities of pure, properly folded protein for structural studies (X-ray crystallography, NMR, or cryo-EM) is technically demanding.

    • Membrane-associated proteins often resist crystallization, requiring alternative approaches like lipid nanodiscs or detergent micelles.

  • Interaction Partners:

    • Identifying proteins that interact with Asc1 in vivo is essential for understanding its complete functional context.

    • Capturing transient or weak interactions requires specialized techniques like cross-linking or proximity labeling.

  • Tissue-Specific Expression:

    • Understanding where and when Asc1 is expressed in planta requires sensitive detection methods and tissue-specific analysis.

    • Correlating expression patterns with disease progression adds another layer of complexity.

Addressing these challenges will require interdisciplinary approaches combining molecular biology, protein biochemistry, structural biology, and plant pathology to fully elucidate Asc1 function in tomato disease resistance.

How might CRISPR-Cas9 technology be applied to study Asc1 gene function and create disease-resistant tomato varieties?

CRISPR-Cas9 technology offers powerful approaches for studying Asc1 gene function and developing disease-resistant tomato varieties:

  • Functional Validation of Mutations:

    • Generate precise edits mimicking naturally occurring mutations (e.g., the two-nucleotide deletion or T-insertion) in resistant backgrounds to confirm their role in susceptibility.

    • Create allelic series by introducing different mutations to determine critical residues for protein function.

    • Perform domain-specific deletions to map functional regions within the Asc1 protein.

  • Promoter Editing:

    • Modify the Asc1 promoter to alter expression levels or patterns, potentially enhancing resistance.

    • Introduce tissue-specific or pathogen-inducible elements to optimize Asc1 expression during infection.

    • Create reporter fusions to study expression dynamics in response to pathogen challenge.

  • Gene Replacement Strategies:

    • Replace susceptible Asc1 alleles with functional versions through homology-directed repair.

    • Introduce optimized Asc1 variants with enhanced stability or activity.

    • Perform cisgenesis by transferring resistant Asc1 alleles between tomato varieties while maintaining their native regulatory elements.

  • Pathway Engineering:

    • Simultaneously edit multiple genes in the ceramide biosynthesis pathway to enhance resistance.

    • Modify regulatory genes that control Asc1 expression in response to pathogen attack.

    • Create synthetic resistance pathways incorporating Asc1 and complementary defense genes.

  • Experimental Protocols:

    • Design specific sgRNAs targeting the Asc1 gene, ensuring minimal off-target effects.

    • Deliver CRISPR-Cas9 components via Agrobacterium-mediated transformation or direct DNA delivery methods.

    • Screen edited plants using sequencing, phenotypic assays, and molecular markers.

    • Confirm stable inheritance of edits through multiple generations.

  • Commercial Development:

    • Stack Asc1 edits with other disease resistance traits to create broadly resistant varieties.

    • Address regulatory considerations by potentially focusing on non-transgenic approaches like transient expression of CRISPR components.

    • Evaluate edited varieties under field conditions to confirm resistance and assess any yield or quality impacts.

This comprehensive CRISPR-based approach would significantly advance both basic understanding of Asc1 function and applied development of resistant tomato varieties.

What are the potential implications of Asc1 research for understanding broader plant immune responses to necrotrophic pathogens?

The research on Asc1 has significant implications for understanding broader plant immune responses to necrotrophic pathogens:

  • Host-Selective Toxin Mechanisms:

    • Asc1 research provides a model for understanding how host-selective toxins target specific metabolic pathways like ceramide biosynthesis .

    • This insight may help identify common mechanisms by which necrotrophic pathogens exploit metabolic vulnerabilities across different plant species.

    • Understanding these mechanisms could lead to targeted breeding strategies for multiple crops affected by toxin-producing pathogens.

  • Evolution of Resistance Genes:

    • The diversity of Asc1 mutations across tomato species offers insights into the evolutionary dynamics of resistance genes .

    • Studies on how resistance alleles are maintained in populations without pathogen pressure may inform broader theories of plant immune system evolution.

    • Comparative genomics across plant families may reveal conserved mechanisms of toxin resistance.

  • Metabolic Immunity:

    • Asc1's role in ceramide biosynthesis highlights the importance of primary metabolism in plant immunity .

    • This connection supports emerging views that integrate metabolic regulation with traditional immune signaling pathways.

    • Targeting metabolic pathways may offer novel strategies for engineering broad-spectrum resistance to necrotrophic pathogens.

  • Translational Applications:

    • Knowledge from Asc1 research could inform resistance breeding in other crops affected by Alternaria species or similar necrotrophic pathogens.

    • Understanding the molecular basis of toxin susceptibility could enable the development of chemical interventions that protect ceramide biosynthesis during infection.

    • Biomarkers based on ceramide pathway metabolites might be developed for early detection of susceptibility across crop species.

  • Integrated Defense Models:

    • Asc1 research contributes to more comprehensive models of plant immunity that incorporate both receptor-mediated recognition and metabolic resistance mechanisms.

    • This integrated understanding may resolve apparent contradictions in how plants respond to biotrophic versus necrotrophic pathogens.

    • New hypotheses about trade-offs between different defense mechanisms can be formulated and tested across pathosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.