Recombinant Solanum nigrum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Solanum nigrum (Black nightshade)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its role in photosynthesis?

Photosystem Q(B) protein, also known as D1 protein or 32 kDa thylakoid membrane protein (EC 1.10.3.9), is a critical component of Photosystem II in photosynthetic organisms. This integral membrane protein functions as an electron acceptor in the photosynthetic electron transport chain. The Q(B) binding site accepts electrons from the primary electron acceptor QA and transfers them to the plastoquinone pool, facilitating the light-dependent reactions of photosynthesis . The protein contains multiple transmembrane domains that help anchor it within the thylakoid membrane where it participates in maintaining the proton gradient necessary for ATP synthesis. Understanding this protein's structure and function is essential for research in photosynthetic efficiency and energy conversion.

How does the amino acid sequence of Solanum nigrum Photosystem Q(B) protein compare to other species?

The amino acid sequence of Solanum nigrum (Black nightshade) Photosystem Q(B) protein shows significant conservation across photosynthetic organisms, reflecting its essential function. The complete amino acid sequence of Solanum nigrum Photosystem Q(B) protein (UniProt: P69563) consists of 344 amino acids . When compared with other species like Leptosira terrestris (UniProt: A6YGB8), key functional domains remain highly conserved while species-specific variations occur in less critical regions .

SpeciesUniProt IDSequence LengthKey Conserved Regions
Solanum nigrumP69563344 amino acidsTransmembrane helices, QB binding pocket
Leptosira terrestrisA6YGB8344 amino acidsTransmembrane helices, QB binding pocket

This conservation suggests evolutionary pressure to maintain functional domains involved in electron transport and quinone binding, while allowing for species-specific adaptations to different environmental conditions.

What are the recommended storage conditions for recombinant Photosystem Q(B) protein?

For optimal stability and activity of recombinant Photosystem Q(B) protein, storage recommendations include keeping the protein at -20°C for routine storage or -80°C for extended preservation . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which helps maintain protein stability during freeze-thaw cycles. It's critical to avoid repeated freezing and thawing, as this can lead to protein denaturation and loss of activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . These storage conditions are designed to preserve the structural integrity and functional activity of the recombinant protein for research applications.

How should researchers validate the purity and activity of recombinant Photosystem Q(B) protein before experiments?

Researchers should implement a multi-step validation process to ensure recombinant protein quality:

  • SDS-PAGE analysis: Verify protein size and initial purity assessment

  • Western blot verification: Confirm protein identity using specific antibodies

  • Mass spectrometry: Analyze for potential contaminants and verify sequence integrity

  • Activity assays: Measure electron transfer capabilities using artificial electron acceptors

  • Multiple supplier comparison: Test proteins from different sources to rule out supplier-specific artifacts

What methods can be used to study electron transfer kinetics in recombinant Photosystem Q(B) protein?

Several complementary approaches can be employed to investigate electron transfer kinetics:

  • Chlorophyll fluorescence: Measures changes in fluorescence yield during electron transfer

  • Spectroelectrochemical analysis: Combines spectroscopy with electrochemistry to monitor redox transitions

  • Chronoamperometry: Provides direct measurement of electron transfer rates to exogenous acceptors

  • EPR spectroscopy: Detects paramagnetic species formed during electron transport

  • Flash photolysis: Monitors electron transfer following short light pulses

Research has demonstrated that structural modifications affecting the distance between QA and exogenous quinones can significantly impact electron transfer rates. For instance, engineering approaches that shorten this distance have successfully increased the reduction rate of exogenous quinones like 2,6-dimethyl-p-benzoquinone (DMBQ) . These methodologies provide complementary data on electron transfer processes, allowing researchers to develop a comprehensive understanding of Photosystem Q(B) protein function in both native and recombinant systems.

How can researchers address potential contamination issues with recombinant Photosystem Q(B) protein preparations?

Addressing contamination concerns requires a systematic approach:

  • Source verification: Compare proteins from multiple suppliers

  • Western blot screening: Test for common contaminants using antibody panels

  • Mass spectrometry profiling: Identify all proteins present in the preparation

  • Activity controls: Include appropriate negative controls to detect non-specific effects

  • Endotoxin testing: Validate preparations are endotoxin-free for cellular assays

How can site-directed mutagenesis of the Photosystem Q(B) protein enhance electron transfer efficiency?

Site-directed mutagenesis offers powerful opportunities to modify electron transfer properties:

  • QB binding pocket modifications: Alterations to amino acids lining the binding pocket can change quinone affinity and positioning

  • Redox potential engineering: Mutations in the protein environment can shift the midpoint potential of electron transfer cofactors

  • Structural optimization: Changes that reduce the distance between electron transfer components can increase transfer rates

Research has demonstrated that rational design approaches can successfully modify electron transfer pathways. For example, structural prediction studies combined with site-directed mutations have identified modifications that increase the reduction rate of exogenous electron acceptors like DMBQ . One effective strategy involved truncating the C-terminus of the PsbT subunit that protrudes into the stroma, which shortened the distance between QA and exogenous acceptors . This modification created a bypass of the natural QA to QB pathway, resulting in sustained electron transfer to artificial acceptors as confirmed by chronoamperometry measurements. Such approaches have significant implications for biophotovoltaic applications and fundamental studies of photosynthetic efficiency.

What is the relationship between proton motive force (pmf) and photoinhibition in systems containing Photosystem Q(B) protein?

The relationship between proton motive force and photoinhibition involves complex regulatory mechanisms:

pmf ComponentEffect on Photosystem IIImpact on Q(B) Protein
ΔpH (pH gradient)Activates photoprotective qEStabilizes electron transfer
Δψ (membrane potential)Increases recombination ratesCan promote photodamage

Research has revealed that while proton motive force is essential for ATP synthesis, its components have distinct effects on photosynthetic regulation and photoinhibition. High membrane potential (Δψ) can accelerate recombination reactions in Photosystem II, particularly through the P+Pheo- pathway, leading to increased production of reactive oxygen species and photodamage . Experiments with ATP synthase mutants have demonstrated a positive correlation between increased Δψ and photoinhibition rates .

Significantly, the redox state of QA (the primary quinone acceptor that transfers electrons to QB) influences this relationship, with more reduced QA states (measured by qL parameter) correlating with higher photoinhibition . This suggests that optimal function of the Q(B) protein depends not just on its structure, but also on the broader energetic context of the thylakoid membrane. Researchers working with recombinant Q(B) proteins should therefore consider these factors when designing experimental systems to evaluate protein function.

How can recombinant Photosystem Q(B) protein be used in artificial photosynthetic systems for energy applications?

Recombinant Photosystem Q(B) protein offers several advantages for artificial photosynthetic systems:

  • Electrode immobilization: The protein can be attached to electrode surfaces to create bio-hybrid energy systems

  • Engineered electron transfer pathways: Modified proteins can direct electrons to non-natural acceptors

  • Increased stability: Protein engineering can enhance stability outside the native membrane environment

  • Optimized kinetics: Mutations can improve electron transfer rates to artificial acceptors

Research demonstrates that strategic modifications to Photosystem II components can enhance electron extraction for biophotovoltaic applications. For example, engineering approaches that shorten the distance between QA and exogenous quinones have successfully increased reduction rates of artificial electron acceptors like DMBQ . These modifications effectively create a bypass of the natural electron transfer pathway, allowing sustained electron donation to external acceptors as verified through chronoamperometry .

What are the most common experimental artifacts when working with recombinant Photosystem Q(B) protein?

Researchers should be vigilant about several common artifacts:

  • Protein aggregation: Can affect electron transfer measurements and spectroscopic analysis

  • Loss of cofactors: Critical for maintaining proper protein function and structural integrity

  • Contaminating proteins: May introduce unintended biological activities and confound results

  • Buffer effects: Can influence protein stability and experimental outcomes

  • Light-induced damage: May occur during handling if proper precautions aren't taken

How can researchers accurately measure the redox potential of recombinant Photosystem Q(B) protein?

Accurate redox potential measurement requires specialized techniques:

  • Spectroelectrochemistry: Combines optical spectroscopy with electrochemical methods to monitor redox transitions

  • Mediated redox titrations: Uses redox mediators with known potentials to determine protein redox properties

  • Protein film voltammetry: Measures electron transfer directly from immobilized proteins

  • EPR-monitored titrations: Combines electron paramagnetic resonance with chemical titrations

  • Computational predictions: Provides theoretical estimates based on protein structure and environment

Each method has specific advantages and limitations. For instance, spectroelectrochemistry allows real-time monitoring of redox changes but may be affected by optical interference, while protein film voltammetry provides direct electrochemical measurements but requires successful protein immobilization. Research has shown that the redox properties of Photosystem II components are significantly influenced by their protein environment, with the membrane potential (Δψ) affecting the equilibrium constant for electron sharing between different acceptors . Understanding these influences is crucial for accurately interpreting experimental results and developing predictive models of electron transfer in both natural and engineered systems.

What considerations are important when comparing recombinant Photosystem Q(B) proteins from different species?

When conducting comparative studies across species, researchers should consider:

  • Sequence homology analysis: Identify conserved domains versus variable regions

  • Structural differences: Evaluate how structural variations might affect function

  • Experimental conditions optimization: Different proteins may require different buffer conditions

  • Evolutionary context: Consider environmental adaptations that may influence protein properties

  • Functional equivalence testing: Verify whether proteins perform similarly in standardized assays

The search results reveal that while Photosystem Q(B) proteins from different species (such as Solanum nigrum and Leptosira terrestris) share significant sequence similarity, they also exhibit species-specific variations . These differences may reflect adaptations to different photosynthetic environments or evolutionary divergence. For example, the amino acid sequence of Solanum nigrum Photosystem Q(B) protein begins with "TAILER..." , while the Leptosira terrestris sequence begins with "MTAILER..." , indicating a small N-terminal difference that might affect protein processing or localization. When designing comparative experiments, researchers should account for these differences by standardizing measurement conditions and using multiple analytical approaches to ensure valid comparisons.

How might genetic engineering of Photosystem Q(B) protein contribute to improved photosynthetic efficiency?

Genetic engineering approaches offer several promising strategies:

  • Optimized electron transfer kinetics: Mutations that enhance the rate-limiting steps in electron transport

  • Expanded spectral sensitivity: Modifications to associated antenna complexes to capture more wavelengths

  • Reduced photoinhibition: Engineering to minimize recombination-induced damage pathways

  • Environmental stress tolerance: Modifications that maintain function under suboptimal conditions

  • Improved repair mechanisms: Enhanced turnover of damaged D1 protein

Research has demonstrated that rational design approaches can successfully modify electron transfer pathways in Photosystem II. For example, studies have shown that modifying the environment of the QA site can increase the reduction rate of exogenous quinones, creating alternative electron transfer pathways . These findings suggest that similar approaches could be applied to enhance natural photosynthetic efficiency by optimizing electron flow through the Q(B) protein.

What emerging technologies might enhance structural and functional studies of Photosystem Q(B) protein?

Several cutting-edge technologies show particular promise:

  • Cryo-electron microscopy: Providing near-atomic resolution of membrane protein complexes

  • Time-resolved X-ray crystallography: Capturing intermediate states during electron transfer

  • Advanced mass spectrometry: Enabling detailed protein-protein interaction mapping

  • Quantum mechanical/molecular mechanical (QM/MM) modeling: Predicting electron transfer pathways with increasing accuracy

  • Single-molecule spectroscopy: Observing heterogeneity in protein behavior

These technologies are revolutionizing our ability to study photosynthetic proteins at unprecedented levels of detail. Cryo-EM has already transformed our understanding of Photosystem II architecture, while advanced computational approaches are providing new insights into the quantum mechanical aspects of electron transfer. Time-resolved techniques are particularly valuable for studying the Q(B) protein, as they can capture the dynamics of electron movement through the protein on physiologically relevant timescales. Combined with genetic engineering approaches, these technologies offer powerful tools for both fundamental research and applied studies aimed at enhancing photosynthetic efficiency or developing bio-inspired energy conversion systems.

What are the key considerations for researchers starting work with recombinant Photosystem Q(B) protein?

Researchers entering this field should prioritize:

  • Rigorous quality control: Implement comprehensive validation of protein purity and activity

  • Multi-technique characterization: Combine structural, spectroscopic, and functional analyses

  • Careful experimental design: Include appropriate controls for potential artifacts

  • Cross-species comparisons: Consider evolutionary and functional context

  • Interdisciplinary approach: Integrate biophysical, biochemical, and molecular biology techniques

The literature highlights particular concerns regarding recombinant protein contamination, which can lead to misinterpretation of experimental results . Researchers should therefore implement stringent quality control measures and validate key findings using proteins from multiple sources. Additionally, understanding the complex relationships between protein structure, electron transfer kinetics, and physiological context is essential for meaningful research in this area . By addressing these considerations systematically, researchers can make significant contributions to our understanding of photosynthetic electron transport and its applications in renewable energy research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.