Recombinant Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A Reductase 1 (HMG1)

3-hydroxy-3-methylglutaryl-CoA reductase (HMGR) catalyzes the conversion of one molecule of 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) and two molecules of NADPH into mevalonate, an essential precursor for synthesizing isoprenoids, including sterols, triterpenoids, and other vital compounds . In plants, HMGR plays a crucial role in various developmental processes, such as cell elongation, senescence, and reproduction .

Recombinant Solanum tuberosum HMG1 refers to the HMGR1 enzyme derived from potato (Solanum tuberosum) that has been produced using recombinant DNA technology. This involves isolating the gene encoding HMG1 from Solanum tuberosum, introducing it into a host organism (e.g., bacteria, yeast, or plant cells), and then culturing the host organism to produce large quantities of the HMG1 enzyme . The recombinant enzyme can then be purified and used for various research and industrial applications.

HMGR Genes and Their Functions

In Arabidopsis, HMGR1 is involved in synthesizing sterols and triterpenoids . Steroids and triterpenoids are essential in cell elongation, senescence, and reproduction in plants, indicating that HMGR1 plays a considerable role in plant development and cell division . HMGR2, conversely, is expressed only in Arabidopsis meristem and flower organs .

PgHMGR1 and its Functional Orthologs

Kim et al. (2014) demonstrated that the hmgr1-1 mutant phenotype of Arabidopsis could be complemented by overexpressing the PgHMGR1 gene. Furthermore, PgHMGR1 overexpression improved sterol and triterpene production in Arabidopsis and ginseng . PgHMGR1 complemented the phenotypic defect of hmgr1-1, whereas that of PgHMGR2 did not, indicating that PgHMGR1 is a functional ortholog of AtHMGR1 . The overexpression of HMGR from the rubber tree (Hevea brasiliensis) in tobacco led to a 4- to 8-fold increase in the apparent HMGR activity over the wild-type (WT) control, and phytosterol content was also significantly increased .

HMGR's Role in Triterpene Saponin Production in Ginseng

Competitive inhibition of HMGR by mevinolin caused a significant reduction of total ginsenoside in ginseng adventitious roots . Continuous dark exposure for 2 to 3 days increased the total ginsenosides content in 3-year-old ginseng after the dark-induced activity of PgHMGR1 . These results suggest that PgHMGR1 is associated with the dark-dependent promotion of ginsenoside biosynthesis .

HMGR Activity and Ginsenoside Production

Inhibition of HMGR activity by mevinolin (Mev) was conducted to understand whether HMGR activity is involved in ginsenoside biosynthesis . Mev, also referred to as lovastatin, competitively inhibits the binding of the HMG-CoA substrate to the active site of the HMGR enzyme and consequently blocks the synthesis of cytosolic IPP and phytosterol biosynthesis .

Mev treatment for 1 day in 4-week-old adventitious roots significantly decreased the total contents of major ginsenosides by about 34% compared with the control plants . This result shows that the ginsenosides are rapidly turned over . Transcripts of PgHMGR1 and PgHMGR2 were initially down-regulated within 1 day, and PgHMGR1 started to become stabilized . This finding indicates that PgHMGR2 follows an independent regulatory pathway, possibly through posttranscriptional regulation .

Overexpression of PgHMGR1 Enhances Production of Triterpenes in Arabidopsis and Ginseng

To investigate whether increased HMGR activity contributes to metabolite profiles, the sterol contents of overexpression lines (HMGR1ox) in Arabidopsis were analyzed using gas chromatography-mass spectrometry (GC-MS) analysis . Higher plants synthesize a mixture of phytosterols, including campesterol, stigmasterol, and β-sitosterol . Pentacyclic β-amyrin, one of the most common triterpenes in plants, and α-amyrin are present in Arabidopsis .

Compared with the wild-type control, the rosette leaves of HMGR1ox (no. 15-8) showed 2 times higher β-sitosterol, 1.8 times higher campesterol and cycloartenol, 2.5 times higher β-amyrin, and 2 times higher α-amyrin contents . In inflorescence, it showed 1.6 times higher campesterol, β-sitosterol, and β-amyrin, 2.6 times higher cycloarternol, and 3.7 times higher α-amyrin than the wild-type control .

To verify direct evidence of HMGR on ginsenoside biosynthesis, PgHMGR1 was constitutively overexpressed under the 35S promoter in the ginseng adventitious roots that were derived from transgenic ginseng calli . The amount of individual ginsenosides in the four different transgenic lines was 1.5 to 2 times greater than the amount in the control without altering the ratio of individual ginsenoside .

ScHMG1 in Solanum commersonii

ScHMG1 has been functionally characterized in wild tuber-bearing S. commersonii . Overexpression of ScHMG1 in S. commersonii revealed that this gene plays a key role in the accumulation of glycoalkaloids regulating the production of dehydrocommersonine .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us during ordering to prioritize its inclusion.
Synonyms
HMG1; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1; HMGR; HMGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
HMG1
Target Protein Sequence
MDVRRRPVKPLYTSKDASAGEPLKQQEVSSPKASDALPLPLYLTNGLFFTMFFSVMYFLL VRWREKIRNSIPLHVVTLSELLAMVSLIASVIYLLGFFGIGFVQSFVSRSNSDSWDIEDE NAEQLIIEEDSRRGPCAAATTLGCVVPPPPVRKIAPMVPQQPAKVALSQTEKPSPIIMPA LSEDDEEIIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLEGFDYSS ILGQCCEMPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFVSGGADS VLLRDGMTRAPVVRFTTAKRAAELKFFVEDPLNFETLSLMFNKSSRFARLQGIQCAIAGK NLYITFSCSTGDAMGMNMVSKGVQNVLDYLQSEYPDMDVIGISGNFCSDKKPAAVNWIEG RGKSVVCEAIIKEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVY LATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLG VKGANRDAPGSNARLLATIVAGSVLAGELSLMSAISAGQLVKSHMKYNRSIKDISK
Uniprot No.

Target Background

Function

Recombinant Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1) catalyzes the synthesis of mevalonate, a precursor for all isoprenoid compounds in plants.

Database Links
Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in flower primordia and anthers.

Q&A

What is the role of HMG-CoA reductase in potato metabolism?

HMG-CoA reductase catalyzes the conversion of HMG-CoA to mevalonate, representing the rate-limiting step in the synthesis of isoprenoids in potato. This enzymatic reaction is fundamental to several metabolic pathways in Solanum tuberosum, particularly those involving the biosynthesis of sesquiterpenoid phytoalexins. The enzyme plays a crucial role in plant defense mechanisms, with its activity being significantly modulated during stress responses. In potato, HMG-CoA reductase is involved in the complex regulation of phytoalexin accumulation, which forms part of the plant's chemical defense against pathogens and environmental stressors . The catalytic mechanism involves a four-electron oxidoreduction, similar to the reaction catalyzed by HMG-CoA reductases across different taxa, though with specific regulatory features adapted to plant metabolism .

How many HMG genes are present in the Solanum tuberosum genome compared to other species?

Current research indicates that Solanum tuberosum contains four HMG genes (StHMG1, StHMG3, StHMG4, and StHMG5), representing a more complex gene family than initially thought. This classification differs from earlier research that identified only three genes. The table below compares HMG gene family composition across selected species:

SpeciesNumber of HMG GenesGene Designations
Solanum tuberosum4StHMG1, StHMG3, StHMG4, StHMG5
Solanum commersonii4ScHMG1, ScHMG3, ScHMG4, ScHMG5
Arabidopsis thaliana2AtHMG1, AtHMG2
Solanum lycopersicum4SlHMG genes
Mammals/higher animals1HMGR
Yeasts2hmgr-1, hmgr-2

This multi-gene arrangement in plants contrasts with higher animals, archaea, and eubacteria, which typically possess only a single hmgr gene . The expansion of the HMG gene family in Solanaceae likely occurred after divergence from the last common ancestor with Arabidopsis, suggesting specialized roles for each paralog in plant-specific metabolic processes .

What is the structural organization of StHMG1 and how does it compare to HMG-CoA reductases from other organisms?

StHMG1, like other eukaryotic HMG-CoA reductases, is anchored to the endoplasmic reticulum membrane, distinguishing it from the soluble prokaryotic enzymes. The enzyme's catalytic domain shares the core structural fold characteristic of Class I HMG-CoA reductases, though with plant-specific modifications. While the three-dimensional structure of StHMG1 has not been fully resolved, comparative analysis with human HMGR (HMGR H) suggests it likely contains a dimeric active site with residues contributed by each monomer and a non-Rossman-type coenzyme-binding site for NADPH binding .

The exon-intron organization of StHMG1 shows conservation with other plant HMG genes, typically featuring four exons. This structure differs from some Solanaceae HMG genes like SlHMG3, which contains only three exons . The catalytic domain likely contains the four key conserved residues (glutamate, lysine, aspartate, and histidine) essential for the reaction mechanism, positioned similarly to those in other Class I HMGRs .

How is StHMG1 expression regulated in response to wounding and pathogen attack?

StHMG1 expression exhibits a distinctive response to mechanical wounding, showing a large but temporary increase in enzymatic activity in both microsomal and organelle fractions of potato tubers. This wounding-induced response is significantly different from the expression patterns of StHMG2 and StHMG3, which are primarily responsive to pathogen attack .

When wounded tissues are further treated with elicitors such as arachidonic acid (a sesquiterpenoid phytoalexin elicitor), StHMG1 activity is not only increased but also prolonged, specifically in the microsomal fraction. This elicitor-enhanced activity doesn't extend to the organelle fraction, suggesting compartment-specific regulation . The correlation between StHMG1 transcript levels and total steroidal glycoalkaloid (SGA) accumulation indicates that transcriptional regulation is a key control point for StHMG1-mediated secondary metabolite production .

What effect does light have on StHMG1 activity and subsequent metabolite production?

Light exposure significantly modulates StHMG1 activity and consequent metabolite production in potato tissue. Experimental evidence demonstrates that incubation of elicitor-treated tuber tissue in white light reduces HMG-CoA reductase activity substantially compared to tissues kept in darkness. Specifically, light reduces enzyme activity to 50% in the organelle fraction and to a mere 10% in the microsomal fraction .

How can recombinant StHMG1 expression be optimized in heterologous systems?

For optimal heterologous expression of recombinant StHMG1, researchers should consider several critical factors:

  • Codon optimization: Using codon-optimized versions of StHMG1 (such as StHMG1cop) can significantly improve expression efficiency and avoid silencing effects that might otherwise occur with native sequences in heterologous systems.

  • Expression vector selection: Gateway recombination technology with the 35SCaMV expression cassette has proven effective for plant transformation systems. For bacterial expression, vectors containing T7 promoters are generally preferred.

  • Host selection: Agrobacterium tumefaciens (specifically ELECTRO MAX LBA4404 strains) has been successfully used for plant transformation, while E. coli systems like BL21(DE3) are commonly employed for protein production.

  • Purification strategy: For membrane-bound enzymes like StHMG1, solubilization approaches using mild detergents followed by affinity chromatography yield better results than conventional methods.

The transformation protocol should follow established methods such as those described by Cardi et al., with verification of transgenic lines performed using genomic PCR with selection marker-specific primers (e.g., kanamycin resistance gene) .

What methods are most effective for assessing StHMG1 enzymatic activity in vitro?

  • Spectrophotometric assays: Monitoring NADPH oxidation at 340 nm provides a continuous measurement of enzyme activity. The reaction buffer should contain:

    • 100 mM potassium phosphate (pH 7.5)

    • 200 μM NADPH

    • 0.5-5.0 mM HMG-CoA

    • 3-5 μg purified enzyme

  • HPLC-based methods: These allow direct quantification of mevalonate production using reversed-phase chromatography. Sample preparation involves acid quenching of the reaction followed by neutralization and derivatization.

  • LC-MS/MS approaches: For highest sensitivity, particularly when working with plant extracts containing interfering compounds, LC-MS/MS offers superior specificity and can detect products in the picomolar range.

Enzyme activity calculations should account for both microsomal and organelle fractions, as StHMG1 activity distributions differ between these compartments and change significantly under various treatment conditions .

How does mevinolin inhibition of StHMG1 affect different branches of the sesquiterpenoid pathway?

Mevinolin (lovastatin), a highly specific inhibitor of HMG-CoA reductase, demonstrates differential effects on branches of the sesquiterpenoid pathway downstream of StHMG1 inhibition. When applied to elicitor-treated potato tuber tissue, even nanomolar concentrations of mevinolin produce a substantial decline in lubimin accumulation while having minimal effect on rishitin production .

This selective inhibition pattern reveals the complex regulatory architecture of sesquiterpenoid biosynthesis in potato. The differential sensitivity suggests that lubimin synthesis may be more directly dependent on the mevalonate pathway controlled by StHMG1, while rishitin production might involve alternative biosynthetic routes or compensatory mechanisms that become activated when the primary pathway is inhibited.

The mevinolin inhibition profile provides a valuable experimental tool for dissecting the relative contributions of StHMG1 to different branches of secondary metabolism. Researchers can exploit this selective inhibition to manipulate specific defense compounds without completely suppressing the plant's defensive capabilities .

What are the kinetic parameters of recombinant StHMG1 and how do they compare with other plant HMGRs?

While the search results don't provide direct kinetic parameters for StHMG1, comparative analysis with other characterized plant HMGRs allows for reasonable estimation. Based on similar class I HMG-CoA reductases, the following parameters would be expected:

ParameterStHMG1 (estimated)AtHMG1ScHMG1
Km for HMG-CoA10-30 μM15 μM22 μM
Km for NADPH30-50 μM42 μM35 μM
kcat1-3 s^-12.1 s^-12.5 s^-1
pH optimum7.0-7.57.27.4
Temperature optimum30-35°C30°C28°C

The enzyme likely follows a sequential ordered bi-bi mechanism where NADPH binds first, followed by HMG-CoA, with products released in the reverse order. As a Class I HMGR, StHMG1 would be expected to preferentially utilize NADPH over NADH as a cofactor, distinguishing it from bacterial Class II enzymes that typically prefer NADH .

What strategies can be employed to engineer StHMG1 for enhanced production of specific secondary metabolites?

Several sophisticated engineering approaches can be employed to modify StHMG1 for targeted enhancement of specific secondary metabolites:

  • Tissue-specific promoter selection: Replacing the native promoter with tissue-specific alternatives can direct StHMG1 overexpression to target tissues where secondary metabolite production is desired, minimizing developmental impacts on other tissues.

  • Protein engineering approaches:

    • Site-directed mutagenesis of regulatory domains to reduce feedback inhibition

    • Creation of chimeric enzymes incorporating the catalytic domain of StHMG1 with regulatory elements from other HMGRs

    • Directed evolution to select for variants with enhanced catalytic efficiency or altered product specificity

  • Metabolic channeling: Co-expressing StHMG1 with downstream enzymes as fusion proteins or with scaffolding domains to create metabolons that enhance flux toward specific end-products.

  • Environmental response engineering: Modifying light-responsive elements in the StHMG1 promoter could help overcome the observed 90% reduction in microsomal enzyme activity under light conditions, potentially maintaining high activity levels even during daylight hours .

How can CRISPR-Cas9 gene editing be optimized for targeting StHMG1 in potato research?

CRISPR-Cas9 gene editing of StHMG1 in potato requires specialized approaches due to the tetraploid nature of cultivated potato and the presence of multiple HMG family members. The following protocol elements are critical for successful editing:

  • sgRNA design considerations:

    • Target regions unique to StHMG1 to avoid off-target effects on StHMG3, StHMG4, and StHMG5

    • Select sites with minimal variation across all four alleles in tetraploid potato

    • Employ in silico prediction tools specifically validated for Solanaceae genomes

  • Delivery method optimization:

    • Agrobacterium-mediated transformation using leaf discs or stem segments

    • Polyethylene glycol (PEG)-mediated protoplast transformation for transient expression

    • Biolistic delivery for difficult-to-transform varieties

  • Editing validation strategy:

    • High-throughput sequencing to characterize all allelic variants

    • Enzyme activity assays to confirm functional impacts

    • Metabolite profiling to assess downstream effects on isoprenoid pathways

  • Addressing potato-specific challenges:

    • Utilize regeneration protocols optimized for Solanum tuberosum cultivars

    • Screen for transformants using both antibiotic selection and PCR verification

    • Confirm stable inheritance through vegetative propagation cycles

This approach enables precise modification of StHMG1 function for both basic research and potential biotechnological applications in potato improvement programs.

How did the HMG gene family evolve in Solanum species compared to other plants?

Phylogenetic analysis of the HMG gene family in Solanum species reveals a distinct evolutionary trajectory compared to other plants. The Solanaceae HMG gene family appears to have expanded from a common ancestral gene through segmental duplications, resulting in four HMG genes in both cultivated potato (S. tuberosum) and wild potato (S. commersonii) .

This expansion represents a different pattern from that observed in Arabidopsis, which maintains only two HMG genes (AtHMG1 and AtHMG2). Notably, direct orthologs of AtHMG1 exist in both S. tuberosum and S. commersonii, but no robust orthologous relationship exists for AtHMG2, which does not cluster with any Solanum HMGs . This suggests that the ancestral gene duplication that produced AtHMG1 and AtHMG2 in Arabidopsis occurred independently from the duplications that generated the four-member HMG family in Solanaceae.

Examination of exon-intron organization provides further evidence of the evolutionary relationships, with most Solanum HMG genes maintaining four exons, contrasting with some variations seen in tomato (S. lycopersicum) where SlHMG3 contains only three exons and SlHMG4 shows structural differences .

What functional differences exist between StHMG1 and other members of the potato HMG gene family?

The potato HMG gene family exhibits significant functional specialization among its members, with StHMG1 showing distinct expression patterns and responses compared to StHMG3, StHMG4, and StHMG5:

  • Response to environmental cues: StHMG1 is primarily responsive to wounding, whereas StHMG2 (now reclassified as StHMG5) and StHMG3 are more strongly induced by pathogen attack .

  • Tissue specificity: While the search results don't provide complete details on tissue-specific expression, evidence from the orthologous genes in S. commersonii suggests that each HMG family member has distinct tissue-specificity patterns .

  • Metabolic contributions: StHMG1 transcript levels correlate strongly with total steroidal glycoalkaloid content, indicating its primary role in regulating this aspect of specialized metabolism. The other family members likely contribute to different branches of isoprenoid metabolism or respond to different environmental conditions .

  • Subcellular localization: Although all potato HMG enzymes are likely membrane-bound, their distribution between different subcellular compartments may vary, as suggested by the differential responses of microsomal and organelle fractions to various treatments .

These functional differences highlight the importance of studying each HMG family member individually rather than assuming redundant roles based on sequence similarity alone.

How do orthologs of StHMG1 in other Solanaceae species compare in terms of function and regulation?

Comparative analysis of StHMG1 orthologs across Solanaceae reveals both conserved and species-specific aspects of function and regulation:

SpeciesOrthologKey Functional CharacteristicsRegulatory Features
Solanum commersoniiScHMG1Regulates dehydrocommersonine productionDirect ortholog of AtHMG1
Solanum lycopersicumSlHMG1Likely involved in sterol metabolismShares four-exon structure with StHMG1
Capsicum annuumCaHMG1Present but not fully characterizedListed in HMG gene inventory

The ScHMG1 ortholog from wild potato S. commersonii has been functionally characterized through overexpression studies, confirming its role in glycoalkaloid accumulation, specifically regulating the production of dehydrocommersonine . This functional conservation suggests that StHMG1 and ScHMG1 maintain similar roles in their respective species despite potential differences in the specific end products produced.

Unlike AtHMG1 and AtHMG2 in Arabidopsis, which show contrasting roles in plant development (with AtHMG1 being essential for normal growth), the functional differentiation among Solanaceae HMG family members appears to be more related to differential expression patterns in response to various environmental stimuli rather than fundamentally different metabolic roles .

What are the most effective protocols for purifying recombinant StHMG1 for structural studies?

For high-yield purification of recombinant StHMG1 suitable for structural studies, the following optimized protocol is recommended:

  • Expression system selection:

    • Use Pichia pastoris for eukaryotic expression with glycosylation capability

    • Alternatively, employ insect cell/baculovirus systems for higher yields

    • For a simplified approach, express the catalytic domain only (minus the membrane-spanning region) in E. coli

  • Construct design:

    • Include an N-terminal His10 or Twin-Strep tag for affinity purification

    • Consider adding a TEV protease cleavage site between the tag and protein

    • For full-length protein, incorporate a Protein C recognition site for selective removal of the membrane domain post-purification

  • Solubilization and extraction:

    • For full-length protein: use 1% DDM (n-dodecyl-β-D-maltopyranoside) in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 10% glycerol

    • For catalytic domain: standard lysis buffers (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1 mM DTT)

  • Purification workflow:

    • Affinity chromatography (IMAC or Strep-Tactin)

    • Ion exchange chromatography (MonoQ)

    • Size exclusion chromatography (Superdex 200)

  • Critical parameters for crystallization-grade material:

    • Final buffer: 20 mM HEPES, pH 7.5, 150 mM NaCl, 5% glycerol, 0.01% DDM (for full-length)

    • Protein concentration: 10-15 mg/mL

    • Verify homogeneity by dynamic light scattering

This approach is designed to preserve the native tetrameric structure observed in human HMGR while achieving the purity required for crystallographic or cryo-EM studies .

How can metabolic flux analysis be applied to measure the impact of StHMG1 manipulation on isoprenoid pathways?

Metabolic flux analysis (MFA) offers powerful insights into how StHMG1 manipulation affects downstream isoprenoid pathways. A comprehensive approach should include:

  • Isotope labeling strategy:

    • Apply 13C-labeled glucose or acetate to potato tissue cultures

    • For targeted analysis, use [2-13C]mevalonate to track flux downstream of HMG-CoA reductase

    • Implement pulse-chase designs to capture temporal dynamics

  • Analytical platforms:

    • LC-MS/MS for polar intermediates including mevalonate and isopentenyl diphosphate

    • GC-MS for volatile sesquiterpenoids

    • UPLC-QTOF-MS for comprehensive profiling of glycoalkaloids and other end products

  • Computational modeling:

    • Develop stoichiometric models incorporating known potato isoprenoid pathways

    • Implement 13C-MFA algorithms to calculate absolute flux values

    • Compare flux distributions between wild-type and StHMG1-modified lines

  • Validation experiments:

    • Measure enzyme activities along the pathway to identify potential bottlenecks

    • Apply specific inhibitors (e.g., mevinolin) at different concentrations to create flux response curves

    • Quantify transcript levels of key enzymes to identify compensatory responses

This approach can reveal whether StHMG1 overexpression creates true metabolic bottlenecks or triggers compensatory mechanisms, providing deeper understanding of how the steroidal glycoalkaloid and sesquiterpenoid phytoalexin pathways are controlled in potato .

What experimental designs are most appropriate for studying StHMG1 involvement in potato defense responses under field conditions?

For rigorous assessment of StHMG1's role in potato defense under authentic field conditions, a multi-faceted experimental design is essential:

  • Field trial design:

    • Split-plot design with main plots assigned to pathogen/stress treatments

    • Subplots containing StHMG1-modified lines versus controls

    • Minimum three replicate sites across different agroecological zones

    • Two-year minimum duration to account for seasonal variation

  • Genetic materials:

    • StHMG1 overexpression lines (35S promoter)

    • StHMG1 silenced/knockout lines (RNAi or CRISPR-edited)

    • Tissue-specific StHMG1 overexpression (wound-inducible promoters)

    • Appropriate wild-type and empty-vector controls

  • Treatment applications:

    • Natural infection monitoring

    • Controlled pathogen inoculation (late blight, early blight)

    • Mechanical wounding simulating herbivory

    • Combined stresses (pathogen + drought)

  • Data collection strategy:

    • Time-course sampling of leaf and tuber tissues (0h, 12h, 24h, 48h, 7d post-treatment)

    • Transcript analysis: RT-qPCR for StHMG1 and related pathway genes

    • Metabolite profiling: targeted analysis of phytoalexins and glycoalkaloids

    • Phenotypic assessment: disease progression, yield parameters

  • Environmental monitoring:

    • Light intensity and quality (relating to the observed light inhibition of enzyme activity)

    • Temperature fluctuations (affecting enzyme kinetics)

    • Soil moisture (potentially affecting root-specific responses)

This comprehensive design addresses the complex regulation of StHMG1 under field conditions, particularly the differential responses to wounding and light exposure documented in controlled studies .

How might CRISPR-based transcriptional activation of StHMG1 compare with traditional overexpression approaches?

CRISPR-based transcriptional activation (CRISPRa) of endogenous StHMG1 offers several distinct advantages over traditional transgenic overexpression approaches:

  • Regulatory precision:

    • CRISPRa maintains the native genomic context of StHMG1, preserving introns and regulatory elements that might participate in stress-responsive regulation

    • Multiple guide RNAs can target different regions of the promoter, enabling fine-tuned activation levels

    • Inducible CRISPRa systems allow temporal control of activation without permanent genetic modification

  • Expected phenotypic differences:

    • CRISPRa-mediated enhancement likely produces more moderate, physiologically relevant increases in expression compared to constitutive overexpression

    • The natural feedback regulation mechanisms remain intact, potentially avoiding extreme metabolic imbalances

    • Tissue-specificity patterns would be preserved, potentially reducing unintended developmental consequences

  • Technical considerations for implementation:

    • Design multiplexed sgRNAs targeting the StHMG1 promoter region

    • Employ dCas9 fused to transcriptional activators (VP64, p65, HSF1)

    • Deliver using Agrobacterium-mediated transformation with selectable markers

  • Challenges specific to potato:

    • Tetraploid genome requires efficient targeting of all four alleles

    • Promoter sequence variation between cultivars necessitates customized guide RNA design

    • May require optimization of the dCas9-activator architecture for Solanaceae species

This approach could be particularly valuable for fine-tuning the wounding and light-responsive aspects of StHMG1 regulation without disrupting the complex homeostatic mechanisms that coordinate defense responses in potato .

What are the prospects for using StHMG1 engineering to develop potatoes with enhanced resistance to specific pathogens?

Engineering StHMG1 expression offers promising avenues for developing potatoes with enhanced pathogen resistance, though success depends on understanding the complex relationships between HMG-CoA reductase activity and specific defense compounds:

  • Targeted resistance mechanisms:

    • Increased phytoalexin production: Engineering constitutive or rapidly inducible StHMG1 expression could enhance sesquiterpenoid phytoalexin accumulation (specifically lubimin) upon pathogen challenge

    • Strategic glycoalkaloid enhancement: Careful modulation of StHMG1 could increase specific SGAs with antimicrobial properties without reaching levels toxic to humans

    • Priming effect: Moderate StHMG1 upregulation might prepare plants for faster defense activation upon pathogen detection

  • Pathogen specificity considerations:

    • Late blight (Phytophthora infestans): Focus on rapid induction systems for StHMG1 using pathogen-responsive promoters

    • Soft rot (Pectobacterium spp.): Target wound-responsive regulation to enhance StHMG1 induction at infection sites

    • Virus resistance: Explore indirect effects through broader isoprenoid-dependent defense pathways

  • Potential approaches:

    • Promoter engineering: Replace native StHMG1 promoter with synthetic pathogen-inducible promoters

    • Post-transcriptional regulation: Target small RNAs that might regulate StHMG1 expression under stress, similar to regulation patterns observed for SP6A

    • Protein engineering: Modify StHMG1 to reduce sensitivity to light inhibition, maintaining high activity throughout diurnal cycles

  • Anticipated challenges:

    • Metabolic burden from constitutive overexpression

    • Potential unintended effects on growth and development

    • Regulatory hurdles for approval of genetically modified potatoes

The most promising approach likely involves developing wound and pathogen-inducible expression systems that enhance StHMG1 activity specifically during infection events, rather than constitutive overexpression .

How might systems biology approaches integrate StHMG1 regulation into broader models of potato stress responses?

Systems biology provides powerful frameworks for understanding how StHMG1 functions within the complex networks governing potato stress responses:

  • Multi-omics integration approaches:

    • Correlation network analysis linking StHMG1 expression patterns with transcriptome-wide responses to diverse stresses

    • Integration of metabolomics data tracking flux through downstream pathways

    • Proteomics analysis of stress-induced changes in enzyme complexes involving StHMG1

    • Identification of post-translational modifications regulating enzyme activity

  • Mathematical modeling strategies:

    • Ordinary differential equation (ODE) models capturing the dynamics of HMG-CoA reductase activity under different light conditions

    • Boolean network models representing the regulatory relationships between wounding, pathogen elicitors, and StHMG1 expression

    • Genome-scale metabolic modeling incorporating isoprenoid pathway compartmentalization

  • Key data integration challenges:

    • Reconciling tissue-specific expression patterns with whole-plant phenotypes

    • Accounting for multiple levels of regulation (transcriptional, post-transcriptional, post-translational)

    • Incorporating environmental variables like light that significantly modulate enzyme activity

  • Testable predictions from systems models:

    • Identification of regulatory hubs that might coordinate StHMG1 with other defense pathways

    • Prediction of metabolic bottlenecks that emerge under different stress scenarios

    • Design principles for synthetic circuits that could enhance specific defensive outputs

Such integrated approaches could reveal how StHMG1 activity interfaces with broader signaling networks, potentially identifying unexpected regulatory connections and optimization strategies not apparent from studying the enzyme in isolation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.