Recombinant Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HMG2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2; HMG2.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
HMG2
Target Protein Sequence
MDVRRRSEKPVYPSKVFGADEKPLKPHNNQQQEDNNTLLIDASDALPLPLYLTNGLFFTM FFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVSRGN NDSWDENDEEFLLKEDSRCGPATTLGCAIPAPPARQISPMAPPQPAMSMVEKPSPLITPA SSEEDEEIINSVVQGKFPSYSLVIQLGDVSAAASLRKEVMQRITGKSLEGLPLEGFTYES ILGQCCEMPIGYVQIPVGIAGPLLLNGKEFSVPMATTEGCLVASTNRGCKAIYASGGATC IVLRDGMTRAPCVRFGTAKRAAELKFFVEDPIKFETLANVFNQSSRFGRLQRIQCAIAGK NLYMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEG RGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVF IATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLG VKGANREAPGSNARLLATVVAGSVLAGELSLMSAISAGQLVNSHMKYNRSTKASS
Uniprot No.

Target Background

Function

Recombinant Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMG2) catalyzes the synthesis of mevalonate, the crucial precursor for all isoprenoid compounds in plants.

Database Links
Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in young flowers and in mature sepals and ovaries.

Q&A

How does HMG2 differ from HMG1 in potato?

Both HMG1 and HMG2 encode 3-hydroxy-3-methylglutaryl coenzyme A reductase in potato, but they represent distinct isoforms with different expression patterns and potentially specialized functions. Sequence diversity analysis reveals that both are subject to purifying selection as genes of primary metabolism . While both catalyze similar reactions in the mevalonic acid pathway, their sequence polymorphisms and expression patterns differ, suggesting potential functional specialization in different tissues or developmental stages. Studies have shown that sequence polymorphisms in HMG2 specifically can separate potato clones with varying SGA accumulation capabilities .

What is the genomic organization of HMG2 in Solanum tuberosum?

HMG2 is a multi-exon gene in the potato genome with both coding and non-coding regions. Sequence analysis has revealed greater polymorphism in the intronic regions compared to exonic sequences . The gene contains regulatory elements that respond to various developmental and environmental stimuli. While exact chromosome location wasn't specified in the provided materials, whole genome SNP genotyping has associated HMG2 with specific loci involved in SGA synthesis and accumulation .

How does HMG2 contribute to steroidal glycoalkaloid biosynthesis in potato?

HMG2 catalyzes a rate-limiting step in the mevalonic acid pathway, which provides essential precursors for SGA biosynthesis. Analysis of an F2 potato population derived from a cross between Solanum chacoense (chc 80-1) and S. phureja (phu DH) demonstrated that plants carrying chc 80-1 alleles of HMG2 exhibited significantly greater accumulation of leptines (specific SGAs) compared to plants with phu DH alleles . This suggests that HMG2 influences the flux of metabolites into the SGA biosynthetic pathway, affecting the ultimate levels of glycoalkaloids produced. Furthermore, there was a significant interaction between HMG2 and SGT2 (solanidine glucosyltransferase), such that plants homozygous for chc 80-1 alleles at both loci expressed the greatest levels of total SGAs, α-solanine, and α-chaconine .

What is the relationship between HMG2 allelic variation and SGA accumulation?

Allelic variation in HMG2 significantly impacts SGA accumulation in potato. Research involving a segregating F2 population revealed that specific allelic sequences of HMG2 derived from Solanum chacoense (chc 80-1) were significantly associated with greater SGA accumulation . The findings indicate that natural variation in this gene contributes to the differential production of defensive compounds among potato species. Sequence polymorphism analysis showed that HMG2 could separate potato clones based on their SGA accumulation capabilities - notably distinguishing the non-SGA-producing clone phu DH or the high-accumulator chc 80-1 from other accessions .

What are the most effective protocols for cloning and expressing recombinant Solanum tuberosum HMG2?

For effective cloning and expression of recombinant Solanum tuberosum HMG2, researchers should follow a multistep approach:

  • Gene Isolation: Begin by extracting total RNA from potato tissue, followed by cDNA synthesis using reverse transcriptase. The HMG2 gene can be amplified using gene-specific primers designed from available sequence data. For maximum yield, target tissues with high HMG2 expression.

  • Cloning Strategy: Insert the amplified gene into an appropriate expression vector containing a strong promoter (such as T7 or CaMV 35S depending on host system) and suitable affinity tags (His-tag or GST-tag) to facilitate purification.

  • Expression Systems:

    • For plant-based expression: Agrobacterium-mediated transformation of Nicotiana benthamiana or potato callus cultures

    • For bacterial expression: E. coli BL21(DE3) strains optimized for membrane protein expression

    • For eukaryotic expression: Yeast (Pichia pastoris) or insect cell (Sf9) systems which better handle post-translational modifications

  • Expression Conditions: Optimize temperature (typically 16-20°C for membrane proteins), inducer concentration, and expression duration to maximize soluble protein yield.

  • Protein Purification: Employ affinity chromatography followed by size exclusion chromatography to obtain pure, active enzyme.

The choice of expression system should consider that HMG2 is a membrane-bound enzyme, requiring proper folding and potential post-translational modifications for activity.

What analytical methods are recommended for characterizing recombinant HMG2 enzyme activity?

Characterization of recombinant HMG2 enzyme activity can be achieved through several complementary analytical approaches:

  • Spectrophotometric Assays: Monitor NADPH oxidation at 340 nm, as HMG-CoA reductase catalyzes the NADPH-dependent reduction of HMG-CoA to mevalonate.

  • Radioisotope-Based Assays: Utilize 14C-labeled HMG-CoA substrate and measure the conversion to mevalonate through scintillation counting after separation.

  • HPLC/LC-MS Methods: Analyze reaction products by HPLC coupled with UV detection or mass spectrometry for more sensitive detection of mevalonate production.

  • Enzyme Kinetics Analysis: Determine kinetic parameters (Km, Vmax, kcat) for HMG2 by measuring initial reaction velocities across varying substrate concentrations.

  • Inhibition Studies: Characterize the response to known HMG-CoA reductase inhibitors (statins) to confirm functional activity and establish a baseline for comparison with novel regulators.

  • Thermal Stability Assays: Employ differential scanning fluorimetry (DSF) to assess protein stability under various conditions.

When conducting these analyses, it's critical to include appropriate controls and ensure the enzyme preparation is stable throughout the experimental period, as membrane-associated enzymes like HMG2 can lose activity during storage.

What approaches are most effective for studying HMG2 allelic variation in diverse potato germplasm?

To effectively study HMG2 allelic variation across diverse potato germplasm, researchers should implement a multi-faceted approach:

  • Targeted Amplicon Sequencing: Amplify genomic DNA coding regions of HMG2 using conserved primers, followed by cloning and sequencing of PCR products to capture allelic diversity . This approach has successfully identified sequence polymorphisms that separate potato clones based on SGA accumulation capabilities.

  • Whole Genome SNP Genotyping: Utilize platforms like SolCAP SNP arrays to perform genome-wide association studies that can identify SNPs within or near HMG2 that correlate with SGA phenotypes .

  • Segregation Analysis: Develop mapping populations from crosses between genotypes with contrasting SGA profiles (e.g., high vs. low producers) to track inheritance patterns of HMG2 alleles and their association with SGA accumulation .

  • RNA-Seq Profiling: Implement transcriptome analysis to assess differential expression of HMG2 alleles under various conditions or across different potato species .

  • Sequence Diversity Analysis: Perform statistical analyses (dN/dS ratios, Tajima's D test) on obtained sequences to evaluate selection pressures acting on the gene .

  • Functional Validation: Express different allelic variants in heterologous systems to directly compare their enzymatic properties and contribution to SGA biosynthesis.

This comprehensive approach has proven effective in studies that revealed HMG2 allelic sequences from S. chacoense (chc 80-1) were significantly associated with greater SGA accumulation in segregating populations .

What are the molecular mechanisms behind the interaction between HMG2 and SGT2 in SGA biosynthesis?

The molecular mechanisms underlying the significant interaction between HMG2 and SGT2 in SGA biosynthesis represent a complex regulatory relationship between primary and secondary metabolism. Based on available research:

  • Pathway Coordination: HMG2 operates early in the mevalonic acid pathway, controlling the flux of precursors toward SGA biosynthesis, while SGT2 (solanidine glucosyltransferase) functions in the final stages, catalyzing the glycosylation of solanidine to γ-chaconine . Their interaction suggests coordinated regulation across different stages of the pathway.

  • Genotypic Interaction Effects: Plants homozygous for S. chacoense (chc 80-1) alleles at both HMG2 and SGT2 loci exhibit the greatest levels of total SGAs, α-solanine, and α-chaconine . This synergistic effect indicates potential co-regulation or functional coupling between these enzymes.

  • Metabolic Channeling: The interaction could involve metabolic channeling mechanisms where intermediates are passed between pathway enzymes through protein-protein interactions or co-localization, enhancing pathway efficiency.

  • Transcriptional Co-regulation: HMG2 and SGT2 may share common transcriptional regulators or be part of a gene expression network that coordinates their activity in response to developmental or environmental signals.

  • Feedback Regulation: The activity of SGT2 and accumulation of its products might influence HMG2 expression or activity through feedback mechanisms to maintain homeostatic control of SGA levels.

While these mechanisms are hypothetical based on observed genetic interactions, further research employing protein-protein interaction studies, subcellular localization experiments, and metabolic flux analysis would be necessary to elucidate the precise molecular basis of this interaction.

How can CRISPR-Cas9 technology be applied to study HMG2 function in potato?

CRISPR-Cas9 technology offers powerful approaches for investigating HMG2 function in potato through precise genome editing. Strategic application would involve:

  • Gene Knockout Studies: Design sgRNAs targeting conserved catalytic domains of HMG2 to create null mutations, allowing assessment of the complete loss of function on SGA biosynthesis, plant development, and stress responses.

  • Allele Replacement: Use homology-directed repair to replace native HMG2 alleles with specific variants (e.g., substituting phu DH alleles with chc 80-1 alleles or vice versa) to directly test the impact of natural allelic variation on SGA accumulation without confounding genetic background effects .

  • Promoter Editing: Modify the HMG2 promoter region to alter expression patterns, creating lines with enhanced or reduced expression to study dosage effects on the mevalonic acid pathway and subsequent SGA production.

  • Domain-Specific Mutations: Introduce precise amino acid substitutions in functional domains to study structure-function relationships and identify critical residues for catalytic activity or regulatory interactions.

  • Reporter Gene Fusions: Create in-frame fusions with fluorescent proteins to monitor HMG2 expression patterns, subcellular localization, and potential changes under different environmental conditions or stresses.

  • Multiplex Editing: Simultaneously target HMG2 and interacting genes like SGT2 to investigate their combined effects on SGA biosynthesis and validate the observed genetic interactions .

  • Regulatory Element Analysis: Delete or modify putative regulatory elements to identify those essential for proper HMG2 expression and regulation.

Implementation would require optimized transformation protocols for potato, careful sgRNA design to minimize off-target effects, and comprehensive phenotypic analysis including metabolite profiling of edited lines.

What statistical approaches are most appropriate for analyzing HMG2 allelic effects on SGA accumulation?

When analyzing HMG2 allelic effects on SGA accumulation, several statistical approaches have proven effective in extracting meaningful insights:

  • Segregation Analysis: For F2 populations derived from crosses between contrasting genotypes (like phu DH × chc 80-1), Chi-square analysis can confirm inheritance patterns of SGA synthesis, such as the observed 15:1 presence/absence ratios for α-solanine and α-chaconine synthesis and 3:1 ratios for leptines I and II .

  • ANOVA and Multiple Comparisons: Analysis of variance with post-hoc tests helps determine significant differences in SGA accumulation between plants with different HMG2 allelic compositions. This approach successfully demonstrated that F2 plants with chc 80-1 alleles for HMG2 showed significantly greater accumulation of leptines compared to plants with phu DH alleles .

  • Regression Analysis: Linear regression can establish relationships between different SGAs, as demonstrated by the positive correlation found between α-solanine and α-chaconine accumulation, as well as between leptine I and leptine II .

  • Factorial Design Analysis: For studying gene interactions, factorial ANOVA can detect significant interactions between HMG2 and other genes (like SGT2) in their effects on SGA accumulation .

  • Sequence Diversity Analysis: Statistical tests including dN/dS ratios and Tajima's D test can evaluate selection pressures acting on HMG2, revealing evolutionary patterns that may relate to its function in SGA biosynthesis .

  • Multivariate Analysis: Principal component analysis (PCA) or cluster analysis can identify patterns in SGA profiles across different genetic backgrounds and help visualize relationships between HMG2 allelic states and multiple SGA compounds simultaneously.

  • Mixed-Effects Models: When working with field trials involving multiple environments or years, mixed-effects models can account for random environmental variation while isolating genetic effects.

These statistical approaches should be accompanied by appropriate data visualization techniques (e.g., boxplots, interaction plots, heatmaps) to effectively communicate findings.

How should researchers interpret contradictory results from in vitro versus in vivo studies of HMG2 activity?

When confronted with contradictory results between in vitro and in vivo studies of HMG2 activity, researchers should consider several factors in their interpretation:

  • Cellular Context Differences: In vitro systems lack the complete cellular machinery, compartmentalization, and regulatory networks present in vivo. For membrane-bound enzymes like HMG2, the lipid environment significantly impacts function and may not be fully replicated in vitro.

  • Post-Translational Modifications: In vivo studies capture the effects of post-translational modifications that may be absent in recombinant systems. By analogy with yeast studies, HMG2 regulation might involve protein misfolding mechanisms induced by specific ligands , which would be difficult to replicate in simplified in vitro assays.

  • Substrate Availability: The concentration and availability of substrates differ between controlled in vitro environments and cellular conditions, potentially affecting enzyme kinetics and apparent activity.

  • Interacting Partners: In vivo, HMG2 may interact with other proteins that modulate its activity. The significant interaction observed between HMG2 and SGT2 in vivo suggests complex regulatory relationships that would be absent in purified enzyme studies.

  • Metabolic Flux: In vivo studies reflect the integrated outcome of entire metabolic pathways, whereas in vitro studies isolate individual reactions. The observed effects of HMG2 allelic variation on SGA accumulation in vivo represent the end result of complex metabolic networks.

  • Reconciliation Strategies:

    • Develop more sophisticated in vitro systems incorporating membrane fractions or reconstituted proteoliposomes

    • Perform intermediate analyses in cellular extracts that maintain some context while allowing controlled manipulation

    • Use heterologous expression systems of increasing complexity to bridge the gap between in vitro and in vivo conditions

    • Apply systems biology approaches to model and predict how isolated biochemical activities translate to pathway outcomes

When publishing findings, researchers should explicitly discuss these contextual differences and avoid overinterpreting either in vitro or in vivo results in isolation.

What bioinformatic tools and databases are most valuable for studying HMG2 across Solanum species?

For comprehensive bioinformatic analysis of HMG2 across Solanum species, researchers should utilize the following tools and databases:

  • Genomic Resources:

    • Solanaceae Genomics Network (SGN): Provides genome assemblies, gene models, and comparative genomics tools for multiple Solanum species

    • SpudDB: Potato-specific genomic database with gene annotation and expression data

    • SolCAP: Contains extensive SNP information for potato, useful for genotyping and association studies

  • Sequence Analysis Tools:

    • MEGA (Molecular Evolutionary Genetics Analysis): For phylogenetic analysis of HMG2 sequences across species

    • DnaSP: Enables calculation of sequence diversity parameters, selection tests (dN/dS), and Tajima's D to assess evolutionary pressures

    • MAFFT/Clustal Omega: For multiple sequence alignment of HMG2 homologs

    • PAML: For detecting positive selection in coding sequences

  • Functional Prediction Tools:

    • SWISS-MODEL: For homology modeling of HMG2 protein structure

    • ConSurf: To identify conserved functional domains across species

    • PROVEAN/SIFT: To predict the functional impact of amino acid substitutions

  • Expression Databases:

    • Potato Expression Atlas: Provides tissue-specific and condition-specific expression data

    • RNA-Seq databases like NCBI SRA: Contains transcriptomic datasets for various potato species under different conditions

  • Metabolic Pathway Databases:

    • PlantCyc/PotatoCyc: Contains curated metabolic pathway information

    • KEGG: Provides pathway mapping and ortholog identification across species

  • Specialized Software:

    • Geneious/Benchling: Integrated platforms for sequence analysis and primer design

    • R packages (e.g., adegenet, poppr): For population genetics analysis of HMG2 variation

    • Primer3Plus: For designing primers spanning specific HMG2 regions for allele sequencing

  • Data Integration Platforms:

    • Galaxy: Web-based platform for accessible bioinformatic analysis

    • Cytoscape: For visualizing gene interaction networks involving HMG2

Effective use of these resources has enabled researchers to identify significant associations between HMG2 allelic variants and SGA accumulation patterns across potato species , providing valuable insights into the genetic control of this important metabolic pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.