Recombinant Solanum tuberosum ADP,ATP carrier protein, mitochondrial (ANT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us beforehand as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
ANT; ADP,ATP carrier protein, mitochondrial; ADP/ATP translocase; Adenine nucleotide translocator; ANT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
78-386
Protein Length
Full Length of Mature Protein
Species
Solanum tuberosum (Potato)
Target Names
ANT
Target Protein Sequence
PQEKGFAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLSEPYKGIGECF GRTIKEEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLAS GGAAGASSLFFVYSLDYARTRLANDRKASKKGGERQFNGLVDVYKKTLKSDGIAGLYRGF NISCVGIIVYRGLYFGMYDSLKPVLLTGNLQDSFFASFGLGWLITNGAGLASYPIDTVRR RMMMTSGEAVKYKSSLDAFSQIVKNEGPKSLFKGAGANILRAVAGAGVLAGYDKLQVLVL GKKFGSGGA
Uniprot No.

Target Background

Function
ADP:ATP antiporter mediates import of ADP into the mitochondrial matrix for ATP synthesis and export of ATP to fuel cellular processes. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating through the alternating access mechanism with a single substrate-binding site that is intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Solanum tuberosum ADP/ATP carrier protein?

The Solanum tuberosum ADP/ATP translocator is encoded by a long open reading frame of 1158 bp, resulting in a 386 amino acid protein with a calculated molecular weight of approximately 42 kDa. This size is significantly larger than the ADP/ATP translocator proteins found in fungi and mammals. The mature protein detected in potato mitochondria is approximately 30 kDa, suggesting post-translational processing. The most distinctive structural feature is an amino-terminal extension of approximately 85 amino acids that is absent in fungal and mammalian homologs .

The protein shows about 75% sequence homology with the Neurospora translocator, but this homology is confined to the region after amino acid 85 of the potato polypeptide, further confirming the unique nature of the N-terminal extension .

How does the potato ADP/ATP carrier differ from similar proteins in other organisms?

The primary distinguishing feature of the Solanum tuberosum ADP/ATP translocator is its amino-terminal extension, which is absent in fungi and mammals. While the core functional regions show high conservation (approximately 75% sequence homology with Neurospora), this N-terminal segment represents a plant-specific adaptation .

In comparison to other plant adenine nucleotide transporters, the potato mitochondrial ANT belongs to the mitochondrial carrier family (MCF), similar to the Arabidopsis mitochondrial ADP/ATP carrier (AAC), which is the most prominent member of this family. MCF proteins typically occur as homodimers, with each monomer contributing to the transport function .

What is the physiological role of the ADP/ATP carrier protein in potato mitochondria?

The mitochondrial ADP/ATP carrier in potato functions primarily as an antiporter that exchanges ATP produced in the mitochondrial matrix for cytosolic ADP. This exchange is crucial for:

  • Maintaining cellular energy homeostasis

  • Facilitating the export of ATP generated through oxidative phosphorylation

  • Ensuring the continued supply of ADP substrate for ATP synthase

  • Balancing nucleotide levels between different cellular compartments

Similar to other plant mitochondrial adenine nucleotide transporters, the potato ANT mediates a counterexchange of ATP and ADP in a 1:1 stoichiometry, which is essential for maintaining balanced nucleotide levels in different cellular compartments and sustaining ATP regeneration via oxidative phosphorylation .

How is the ADP/ATP carrier protein targeted to potato mitochondria?

The unique N-terminal extension of the Solanum tuberosum ADP/ATP translocator likely functions as a mitochondrial targeting sequence. Unlike fungal and mammalian homologs that lack presequences, the potato ANT possesses this extended N-terminal region that appears to direct the protein to mitochondria .

The targeting mechanism likely involves:

  • Recognition of the N-terminal sequence by cytosolic chaperones

  • Interaction with the mitochondrial import machinery

  • Translocation across the outer and inner mitochondrial membranes

  • Proteolytic cleavage of the targeting sequence, explaining the 30 kDa mature protein observed in potato mitochondria versus the 42 kDa full-length translation product

This represents an interesting adaptation in plant mitochondrial protein import that differs from the mechanism used for the same protein in fungi and mammals.

What is the tissue-specific expression pattern of the ADP/ATP carrier in potato?

Based on the available data, high levels of transcripts for the ADP/ATP translocator are found in all potato tissues analyzed . This widespread expression pattern is consistent with the fundamental role of this protein in cellular energy metabolism across different tissue types.

While only one class of cDNA clones was identified in the specific study referenced, the authors suggest that different translocator genes might be expressed in other tissues not examined in their investigation . This indicates potential tissue-specific isoforms that could be adapted to the particular energy requirements of different potato tissues.

What expression systems are optimal for producing recombinant Solanum tuberosum ANT?

For functional characterization of adenine nucleotide transporters, Escherichia coli has been successfully used as a heterologous expression system. This approach has been demonstrated to functionally integrate several plastidic and mitochondrial membrane proteins into the bacterial cytoplasmic membrane .

When using E. coli for ANT expression:

  • The protein can be targeted to the bacterial cytoplasmic membrane

  • Transport activity can be measured in intact bacterial cells

  • The system allows for time-linear import studies of radiolabeled nucleotides

  • Kinetic parameters can be determined using this system

For example, in studies with the ER-ANT1 from Arabidopsis, E. coli cells harboring the recombinant transporter showed clear time-linear import of both [α-32P]ATP and [α-32P]ADP, while non-induced control cells showed negligible transport activity .

How can the transport activity of recombinant ANT be measured experimentally?

The transport activity of recombinant ADP/ATP carrier protein can be assessed using several approaches:

Method 1: Radiolabeled substrate uptake in intact bacterial cells

  • Express the ANT protein in E. coli under an inducible promoter

  • Incubate intact bacterial cells with radiolabeled substrates ([α-32P]ATP or [α-32P]ADP)

  • Monitor time-dependent uptake of the radiolabeled nucleotides

  • Compare with non-induced control cells to determine specific transport activity

This approach has demonstrated that nucleotide uptake mediated by ANT follows Michaelis-Menten kinetics, allowing determination of apparent Km values for different substrates .

Method 2: Competition experiments to determine substrate specificity

  • Perform [α-32P]ATP import assays in the presence of potential competing substrates

  • Calculate the relative transport rate compared to control conditions

  • Determine which compounds significantly reduce labeled substrate uptake

Using this approach with ER-ANT1, it was shown that only ATP and ADP significantly competed for transport, reducing [α-32P]ATP import to below 44% and 38% of control values, respectively .

What methods can be used to study ANT protein insertion into membranes?

To study the membrane insertion and topology of ANT proteins, several complementary approaches can be used:

  • Immunodetection in transgenic plants: Using epitope-tagged versions of the protein (e.g., C-MYC tag) allows for specific antibody detection in cellular fractions .

  • Immunogold labeling: This electron microscopy technique can provide high-resolution localization of the protein in specific membrane compartments, as demonstrated with ER-ANT1 in Arabidopsis pollen grain tissue .

  • Proteoliposome reconstitution: Purified ANT can be reconstituted into artificial lipid vesicles to study its transport properties in a defined membrane environment, similar to studies performed with yeast microsomal membranes .

  • GFP fusion proteins: Creating ANT-GFP fusion constructs allows for live-cell imaging of protein localization and dynamics.

What amino acid residues are essential for the transport function of ADP/ATP carrier proteins?

Based on comparative studies with yeast and bovine ADP/ATP carriers, several key amino acid residues are likely critical for the function of the potato ANT. In the yeast mitochondrial AAC2, six Arg residues and one Lys (R96, R204, R252, R253, R254, R294, and K38) were found to be crucial for transport activity .

The corresponding amino acids in Arabidopsis ER-ANT1 (R83, R192, R240, R241, R242, L282, and K25) are almost identical, with the exception that R294 is replaced by L282. This high conservation suggests similar residues would be important in the potato ANT .

Additionally, structural studies of bovine AAC1 identified a cationic cluster in the translocation channel consisting of:

Bovine AAC1Arabidopsis ER-ANT1 equivalent
K22K25
K32K35
R79R83
R137R140
R234R192
R235R240
R236R241
R279R242

These positively charged residues are stabilized by a hydrogen bond network involving acidic or polar side chains (E29, D134, D231, Q36, E264, and N276 in bovine AAC1), which are also conserved in the plant transporters .

How do the kinetic properties of potato ANT compare with other adenine nucleotide transporters?

While specific kinetic data for the potato ANT is not provided in the search results, we can infer some properties based on related transporters. The Arabidopsis ER-ANT1, which shares functional similarities with mitochondrial ANT proteins, displays the following kinetic characteristics:

  • Michaelis-Menten kinetics for nucleotide transport

  • Apparent Km values of 343.7 ± 20.4 μM for ATP and 327.3 ± 24.4 μM for ADP

  • High specificity for ATP and ADP, with limited transport of other nucleotides

  • Operates in a counterexchange mode with 1:1 stoichiometry

Given the structural and functional similarities between plant adenine nucleotide transporters, the potato mitochondrial ANT likely exhibits comparable kinetic properties, though with potential adaptations specific to its mitochondrial localization and physiological role.

What is the evolutionary significance of the N-terminal extension in plant ADP/ATP carriers?

The presence of an N-terminal extension in the potato ADP/ATP translocator that is absent in fungal and mammalian homologs suggests an evolutionary adaptation specific to plants. This extension likely serves as a mitochondrial targeting sequence, indicating that plants have evolved a different targeting mechanism for this essential metabolic protein .

This evolutionary divergence raises several interesting questions:

  • Why did plants evolve a presequence-dependent import mechanism for ANT while fungi and mammals use a presequence-independent pathway?

  • Does the N-terminal extension provide additional regulatory functions beyond targeting?

  • When did this structural adaptation emerge during plant evolution?

The fact that the core functional domain of the protein maintains high sequence homology (approximately 75%) with fungal transporters indicates strong evolutionary constraints on the transport mechanism itself, while allowing flexibility in the targeting strategy .

What factors affect transgene expression stability when studying recombinant ANT in potato systems?

When establishing transgenic potato lines for ANT studies, several factors can influence the stability of transgene expression:

  • Number of T-DNA insertions: Plants with multiple T-DNA insertions tend to show decreased transgene expression over time compared to those with single insertions. This is particularly evident in lines with initially higher expression levels .

  • Insertion site: The location of transgene integration can significantly impact expression stability, though some studies suggest that single-copy T-DNA lines may show comparable expression regardless of integration site .

  • Time since transformation: Expression changes often occur long after integration, with some transgenes becoming silenced after extended periods. Nearly 25% of transgenic potato lines showed complete silencing of reporter genes over a 5-year period of vegetative propagation .

  • Epigenetic factors: DNA methylation plays a significant role in transgene silencing, as demonstrated by the ability of demethylation drugs like 5-azacytidine to reactivate silenced transgenes .

  • Transgene arrangement: Inverted repeats of transgenes can produce double-stranded RNA, potentially triggering post-transcriptional gene silencing mechanisms .

What methods can be used to maintain stable expression of recombinant ANT in transgenic potato systems?

To maintain stable expression of recombinant ANT in transgenic potato systems:

  • Select single-copy insertion lines: Prioritize lines with single T-DNA insertions, as these tend to show more stable expression over time .

  • Monitor expression regularly: Regularly assess expression levels using reporter genes or direct measurement of ANT protein/activity.

  • Epigenetic modification inhibitors: For research purposes, treatment with DNA methylation inhibitors like 5-azacytidine can reactivate silenced transgenes. In one study, leaf explants from silenced plants treated with 10 μM 5-azacytidine showed reactivation of previously silenced expression .

  • Optimize promoter selection: Use promoters that are less susceptible to silencing mechanisms.

  • Consider de novo regeneration: In some cases, de novo regeneration from transgenic plant tissue can result in reactivation of silenced transgenes .

How can researchers overcome challenges in functional characterization of recombinant potato ANT?

Common challenges in ANT functional studies include protein misfolding, improper membrane insertion, and loss of transport activity. Strategies to address these issues include:

  • Optimizing expression conditions: Adjust induction parameters, growth temperatures, and expression duration to maximize functional protein production.

  • Membrane mimetics: Use detergents or lipid environments that preserve protein structure and function during purification and reconstitution.

  • Construct design: Include affinity tags that minimally impact function and consider the position of the tag (N-terminal tags may interfere with targeting sequences).

  • Control experiments: Always include appropriate controls such as non-induced cells or known transport inhibitors to validate assay specificity.

  • Alternative assay methods: If direct transport measurements are challenging, consider alternative approaches such as complementation assays in yeast mutants lacking endogenous ANT function.

What are the critical parameters for measuring ADP/ATP transport activity in reconstituted systems?

When measuring ANT transport activity in reconstituted systems:

  • Membrane integrity: Ensure that bacterial cells or liposomes maintain membrane integrity throughout the assay. Transport experiments with the Arabidopsis ER-ANT1 showed that nucleotide uptake was strictly dependent on E. coli cell membrane intactness .

  • Time linearity: Verify that substrate uptake remains linear over the measurement period. For example, [α-32P]ATP or [α-32P]ADP import by recombinant ER-ANT1 showed time-linear behavior for at least 25 minutes .

  • Substrate concentration range: Use appropriate substrate concentrations spanning the Km value to accurately determine kinetic parameters.

  • Temperature control: Maintain consistent temperature during transport assays as carrier activity is temperature-dependent.

  • Counter-substrate availability: For antiporters like ANT, the presence or absence of counter-substrates can significantly affect measured transport rates.

By carefully controlling these parameters, researchers can obtain reliable measurements of ANT transport activity and accurately determine its functional properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.