Recombinant Solanum tuberosum ADP,ATP carrier protein, mitochondrial (ANT1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Solanum tuberosum ANT1 is expressed in Escherichia coli with an N-terminal His tag for purification and detection . Key specifications include:

PropertyDetail
UniProt IDP27081 (ANT1)
Protein LengthFull-length mature protein (77–386 amino acids)
Expression SystemE. coli cytoplasmic membrane
Purity≥85% (SDS-PAGE) , ≥90% (lyophilized)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Sequence FeaturesConserved substrate-binding motifs (e.g., R83, R140, R192)

2.2. Transport Mechanism

  • Substrate Specificity: ANT1 mediates ATP/ADP antiport with apparent Kₘ values of ~300–350 μM .

  • Competitive Inhibition: ATP and ADP reduce transport rates by 60–70%, while AMP has no effect .

Applications in Research

  • Functional Studies: Used to characterize mitochondrial energy transport in plants .

  • Protein-Protein Interaction Assays: His-tagged ANT1 enables pulldown experiments to identify binding partners .

  • Structural Biology: Serves as a template for crystallography studies of AAC family proteins .

4.1. Knockout Phenotypes

In Arabidopsis ER-ANT1 mutants, ATP deficiency disrupts ER-dependent processes (e.g., root development, chaperone expression) . While Solanum ANT1 is mitochondrial, analogous energy deficits likely impair oxidative phosphorylation and stress responses .

4.2. Evolutionary Conservation

ANT1 shares 70–80% sequence homology with mitochondrial AACs in yeast and mammals, underscoring its role in energy homeostasis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice packaging, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which serves as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C. Lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ANT1; AAC; ADP,ATP carrier protein, mitochondrial; ADP/ATP translocase; Adenine nucleotide translocator; ANT; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
77-386
Protein Length
Full Length of Mature Protein
Species
Solanum tuberosum (Potato)
Target Names
ANT1
Target Protein Sequence
PQEKGLAAFATDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCF SRTIKDEGFAALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLAS GGGAGASSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGLVDVYRKTLKSDGVAGLYRG FNISCVGIIVYRGLYFGMYDSLKPVLLTGKMEDSFFASFALGWLITNGAGLASYPIDTVR RRMMMTSGEAVKYKSSFDAFNQILKNEGPKSLFKGAGANVLRAVAGAGVLAGYDKLQVIV FGKKYGSGGG
Uniprot No.

Target Background

Function
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis and export of ATP to fuel the cell. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating by the alternating access mechanism with a single substrate-binding site that is intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Solanum tuberosum mitochondrial ANT1 and how does it compare to other ANT proteins?

The Solanum tuberosum (potato) mitochondrial ANT1 functions primarily as an adenine nucleotide transporter that facilitates the exchange of ATP and ADP across the mitochondrial inner membrane. Unlike some other adenine nucleotide transporters such as the plastidic ATP/ADP transporter (NTT), which is structurally unrelated to the mitochondrial carrier family (MCF), ANT1 belongs to the MCF and typically exhibits a molecular mass of approximately 30-35 kDa .

While most mitochondrial ANTs like those found in humans mediate a strict ATP/ADP antiport, it's important to note that the potato homolog (St BT1) demonstrates distinct transport characteristics. Unlike typical ANTs, St BT1 has been shown to mediate a uniport of AMP, ADP, and ATP, suggesting it plays a specialized role in providing adenine nucleotides synthesized in plastids to the cytosol and potentially other cellular compartments .

For research purposes, understanding this functional distinction is critical when designing transport assays or interpreting experimental results comparing different ANT family members.

What are the critical amino acid residues for ANT1 function and how can researchers identify them?

Based on comparative studies with yeast and bovine AACs (ADP/ATP carriers), several conserved amino acid residues appear critical for ANT function. In yeast AAC2, six arginine residues (R96, R204, R252, R253, R254, R294) and one lysine (K38) were identified as crucial for ADP/ATP transport activity through site-directed mutagenesis .

When studying Solanum tuberosum ANT1, researchers should examine whether the corresponding residues are conserved. For example, in Arabidopsis ER-ANT1, most of these residues are conserved (R83, R192, R240, R241, R242, L282, and K25), with R294 being replaced by L282 .

To identify critical residues in potato ANT1, researchers should:

  • Perform sequence alignment with well-characterized ANTs

  • Target conserved charged residues for site-directed mutagenesis

  • Express mutated proteins and assess transport activity

  • Focus particularly on arginine and lysine residues within transmembrane domains

The cationic cluster identified in the translocation channel of bovine AAC1 (K22, K32, R79, R137, R234, R235, R236, and R279) and the associated hydrogen bond network involving acidic and polar residues (E29, D134, D231, Q36, E264, and N276) offers a template for investigating similar functional domains in potato ANT1 .

What expression systems are most effective for producing functional recombinant potato ANT1?

For functional expression of mitochondrial carrier proteins like potato ANT1, several expression systems have proven effective, with each offering distinct advantages:

Bacterial Expression (E. coli):

  • Most commonly used for initial characterization

  • The functional integration of membrane proteins into the bacterial cytoplasmic membrane has been demonstrated for several plastidic and mitochondrial proteins, including adenine nucleotide transporters

  • Advantages include rapid growth, high yields, and cost-effectiveness

  • Limitations include potential protein misfolding and lack of post-translational modifications

Protocol outline:

  • Clone ANT1 coding sequence into an appropriate vector (e.g., pET, pQE)

  • Transform into E. coli expression strains (BL21, C41, or C43 recommended for membrane proteins)

  • Induce protein expression at lower temperatures (16-20°C) to minimize inclusion body formation

  • Verify functional integration into the bacterial membrane through transport assays with intact cells

Yeast Expression Systems:

  • Saccharomyces cerevisiae or Pichia pastoris

  • More likely to provide proper folding and some post-translational modifications

  • Particularly useful for functional studies, as demonstrated with Arabidopsis ER-ANT1

Insect Cell Systems:

  • Preferable for structural studies requiring higher yields of properly folded protein

  • Required for proteins needing specific eukaryotic modifications

The choice should be guided by the specific research goals. For basic transport studies, bacterial expression may be sufficient, while structural analyses typically require eukaryotic systems.

What methodologies can reliably assess the transport activity of recombinant potato ANT1?

In Bacterial Systems:
The most direct approach for assessing ANT1 function involves measuring adenine nucleotide transport in E. coli cells expressing the recombinant protein:

  • Intact Cell Transport Assays:

    • Express ANT1 in E. coli

    • Incubate cells with radiolabeled substrates ([³H]ATP, [³H]ADP)

    • Separate cells from media by rapid filtration

    • Measure intracellular radioactivity using scintillation counting

    • Compare transport rates between ANT1-expressing cells and control cells (empty vector)

  • Transport Kinetics Analysis:

    • Determine Km and Vmax values by varying substrate concentrations

    • Assess substrate specificity by competition experiments

    • Investigate effects of inhibitors (e.g., bongkrekic acid, atractyloside)

In Reconstituted Liposomes:
For more controlled analyses:

  • Purify recombinant ANT1 using detergent solubilization

  • Reconstitute purified protein into liposomes

  • Measure substrate transport across liposomal membranes

This methodology offers advantages for determining:

  • Exact stoichiometry

  • Substrate specificity

  • Inhibitor sensitivity

  • Direction of transport

How can researchers investigate the quaternary structure and potential interactions of potato ANT1?

Mitochondrial ANT proteins typically function as dimers or higher-order structures. To investigate potato ANT1 quaternary structure and interactions:

Blue Native PAGE Analysis:

  • Solubilize mitochondrial membranes with mild detergents (digitonin, n-dodecyl-β-D-maltoside)

  • Separate protein complexes on gradient gels

  • Identify ANT1-containing complexes via immunoblotting

Crosslinking Studies:

  • Treat intact mitochondria or recombinant protein with chemical crosslinkers

  • Analyze products via SDS-PAGE and immunoblotting

  • Identify crosslinked partners using mass spectrometry

Co-immunoprecipitation:
Particularly useful for identifying interacting partners that may regulate ANT1 function, such as potential interactions with other mitochondrial proteins.

Potential ANT1 Interacting Partners:
Based on studies of other ANTs, researchers should investigate interactions with:

  • Components of the mitochondrial permeability transition pore (MPTP)

  • Bcl-2 family members (Bax, Bcl-2)

  • Mitochondrial membrane proteins involved in energy metabolism

It's important to note that ANT1 has been identified as a component of the MPTP and may interact with apoptotic regulators. For example, in other systems, ANT1 interacts with Bax or Bcl-2 during MPTP opening .

How does ANT1 overexpression affect cell viability and what methodologies should be used to study this?

While specific data for potato ANT1 is limited, research on human ANT1 provides a methodological framework applicable to studying ANT1 from various species:

Key Findings from Human ANT1 Research:

  • ANT1 overexpression induces apoptotic cell death

  • The process involves disruption of mitochondrial membrane potential (MMP)

  • ANT1-induced apoptosis is associated with cytochrome c release and caspase activation

  • ANT1 overexpression affects NF-κB signaling and modulates expression of Bcl-2 family proteins

Methodological Approach for Potato ANT1:

  • Establishing Expression Systems:

    • Create expression vectors containing potato ANT1 coding sequence

    • Transfect appropriate cell lines (plant or heterologous systems)

    • Verify expression levels using RT-PCR and Western blotting

  • Cell Death Assessment Methods:

    • Annexin V-PI staining followed by flow cytometry analysis

    • DNA fragmentation assays to detect DNA laddering characteristic of apoptosis

    • Cell viability assays (MTT, XTT, or ATP-based assays)

  • Mitochondrial Function Analysis:

    • Measure mitochondrial membrane potential using fluorescent dyes (DiOC₆, JC-1, TMRM)

    • Assess cytochrome c release via subcellular fractionation and immunoblotting

    • Measure caspase activation using specific substrates or immunoblotting

  • Signaling Pathway Investigation:

    • Analyze Akt phosphorylation status

    • Measure Bcl-2 family protein levels (Bcl-xL, Bax-α)

    • Assess NF-κB activity through:

      • Confocal microscopy to track NF-κB translocation

      • Western blotting of nuclear fractions

      • Luciferase reporter assays for transcriptional activity

MethodPurposeKey Readout
Annexin V-PIEarly apoptosis detection% of Annexin V+/PI- and Annexin V+/PI+ cells
DNA ladderingLate apoptosis confirmationPresence of ~180 bp DNA fragments
DiOC₆ stainingMitochondrial membrane potentialDecreased fluorescence indicates MMP loss
Western blottingProtein expression/activationChanges in Bax/Bcl-xL ratio, caspase cleavage
NF-κB luciferase assayTranscriptional activityReduced luciferase activity with ANT1 expression

What considerations should researchers address when studying ANT1 in transgenic plant systems?

When designing experiments with transgenic plants expressing modified ANT1:

  • Promoter Selection:

    • Choose tissue-specific promoters for targeted expression

    • Use inducible promoters to control expression timing and avoid developmental effects

    • For potato ANT1, consider promoters active in tissues with high metabolic demands

  • Phenotypic Analysis:

    • Monitor plant growth parameters (height, leaf area, root development)

    • Assess developmental timing and reproductive capacity

    • Document stress tolerance and metabolic changes

  • Molecular Characterization:

    • Verify transgene expression in target tissues via RT-PCR and protein detection

    • Analyze effects on endogenous gene expression, particularly energy metabolism genes

    • Consider RNA-seq to identify broader transcriptional changes

  • Functional Measurements:

    • Measure ATP/ADP ratios in relevant tissues

    • Assess mitochondrial function through oxygen consumption

    • Monitor reactive oxygen species levels

Transgenic approaches with adenine nucleotide transporters have demonstrated significant physiological impacts. For example, ER-ANT1 knockout in Arabidopsis resulted in growth retardation and impaired root and seed development, demonstrating the physiological importance of these transporters .

How does potato ANT1 compare functionally to other adenine nucleotide transporters, and what methodologies enable reliable comparative studies?

Adenine nucleotide transporters show remarkable diversity across species and cellular compartments. Comparative studies of potato ANT1 should consider:

Types of Adenine Nucleotide Transporters:

  • Mitochondrial ANTs/AACs:

    • Typically mediate strict ATP/ADP exchange

    • Critical for energy metabolism

    • Well-conserved across eukaryotes

  • Plastidic Transporters:

    • Different substrate specificities and transport mechanisms

    • Solanum tuberosum BT1 mediates uniport of AMP, ADP, and ATP

    • Provides adenine nucleotides synthesized in plastids to other compartments

  • ER-localized Transporters:

    • Recently identified (e.g., Arabidopsis ER-ANT1)

    • Support ATP-dependent processes in the ER lumen

Methodological Approaches for Comparative Studies:

  • Sequence Analysis:

    • Multiple sequence alignment to identify conserved domains

    • Phylogenetic analysis to establish evolutionary relationships

    • Focus on key functional residues identified in well-characterized ANTs

  • Expression in Common Host Systems:

    • Express different ANTs in the same bacterial or yeast system

    • Conduct parallel transport assays under identical conditions

    • Compare kinetic parameters (Km, Vmax, substrate specificity)

  • Inhibitor Studies:

    • Assess sensitivity to known ANT inhibitors

    • Compare inhibition profiles to distinguish transporter classes

  • Chimeric Protein Analysis:

    • Create fusion proteins exchanging domains between different ANTs

    • Identify regions responsible for specific transport properties

Evolutionary Insights:

The mitochondrial and plastidic adenine nucleotide transporters represent distinct protein families with independent evolutionary origins. While mitochondrial ANTs belong to the mitochondrial carrier family, plastidic ATP/ADP transporters (NTT) exhibit different structure with 12 predicted transmembrane helices and approximately 60 kDa molecular mass .

Conservation analysis of key residues provides insights into functional evolution. For example, the critical arginine residues essential for yeast AAC2 function (R96, R204, R252, R253, R254, R294) are largely conserved in plant ANTs, with potential adaptive substitutions like the R294-to-L282 replacement observed in Arabidopsis ER-ANT1 .

What are the common issues encountered when working with recombinant ANT1 and how can researchers address them?

Working with membrane proteins like ANT1 presents several technical challenges. Here are methodological approaches to address common issues:

Challenge 1: Low Expression Levels

Solution:

  • Optimize codon usage for expression host

  • Test different expression vectors and promoters

  • Explore alternative expression hosts (bacterial, yeast, insect cells)

  • Reduce expression temperature (16-20°C) to improve folding

  • Consider fusion partners that enhance expression (e.g., MBP, SUMO)

Challenge 2: Protein Misfolding and Aggregation

Solution:

  • Use specialized E. coli strains designed for membrane proteins (C41, C43)

  • Add chemical chaperones to expression media (glycerol, betaine)

  • Co-express molecular chaperones

  • Optimize detergent selection for solubilization:

    • Try milder detergents (DDM, digitonin)

    • Screen detergent concentrations systematically

    • Consider lipid supplementation during solubilization

Challenge 3: Loss of Function During Purification

Solution:

  • Verify functionality in the expression host before purification

  • Maintain physiological pH and ionic conditions

  • Include stabilizing ligands during purification

  • Minimize time between solubilization and reconstitution

  • Consider purification in nanodiscs or amphipols

Challenge 4: Reliable Transport Assays

Solution:

  • Include appropriate controls:

    • Empty vector controls

    • Heat-inactivated protein samples

    • Well-characterized related transporters as positive controls

  • Optimize assay conditions:

    • Buffer composition

    • pH

    • Temperature

    • Substrate concentrations

  • Consider alternative measurement approaches:

    • Direct radioisotope transport measurements

    • Indirect coupling to fluorescent reporters

    • Electrophysiological approaches for reconstituted systems

What are the promising avenues for future research on potato ANT1 and related transporters?

Based on current knowledge of adenine nucleotide transporters, several research directions could advance understanding of potato ANT1:

  • Structural Studies:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Investigate conformational changes during transport cycle

    • Compare with structures of other plant and animal ANTs

  • Physiological Roles in Stress Response:

    • Investigate ANT1 regulation during biotic and abiotic stress

    • Examine potential role in programmed cell death pathways in plants

    • Explore correlation between ANT1 expression and stress tolerance

  • Regulatory Networks:

    • Identify transcriptional and post-translational regulation mechanisms

    • Map protein-protein interactions in different cellular states

    • Characterize how ANT1 activity coordinates with other energy metabolism pathways

  • Biotechnological Applications:

    • Develop ANT1 variants with altered transport properties

    • Explore potential for enhancing crop stress tolerance or yield

    • Investigate therapeutic applications based on ANT1's role in cell death

  • Comparative Studies Across Species:

    • Expand functional characterization to ANTs from diverse plant species

    • Identify adaptation of transport properties to different ecological niches

    • Trace evolutionary trajectory of ANT function in relation to metabolic demands

The multifaceted roles of ANT proteins in cellular energy metabolism, stress response, and programmed cell death make them compelling targets for both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.