Recombinant Solanum tuberosum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Solanum tuberosum (Potato)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKTNILVVGPVPG KKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Recombinant Solanum tuberosum Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), supports cyclic electron flow around PSI, and participates in state transitions.

Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Solanum tuberosum?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of potato (Solanum tuberosum). This protein facilitates electron transfer between photosystem II and photosystem I during photosynthesis. In its mature form, the protein spans amino acids 36-320 and contains heme-binding domains that are essential for its electron transport function. The recombinant protein allows researchers to study the structural and functional properties of this important photosynthetic component outside its native environment .

How should recombinant Solanum tuberosum Apocytochrome f (petA) be stored for optimal stability?

For optimal stability, store recombinant Apocytochrome f (petA) at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality. For short-term storage, working aliquots may be kept at 4°C for up to one week. The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability. When preparing for long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being commonly used) to prevent freeze damage and maintain protein integrity .

What is the recommended reconstitution procedure for lyophilized Apocytochrome f (petA)?

For optimal reconstitution of lyophilized Apocytochrome f (petA), first briefly centrifuge the vial to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. After dissolution, it is recommended to add glycerol to a final concentration of 5-50% (typically 50%) and aliquot for long-term storage at -20°C/-80°C. This procedure minimizes protein degradation and maintains functional integrity for downstream applications. Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity and yield .

How can the purity and integrity of recombinant Apocytochrome f (petA) be verified before experimental use?

To verify the purity and integrity of recombinant Apocytochrome f (petA) before experimental use, employ the following methodological approach:

  • SDS-PAGE analysis: Run the protein on a reducing gel alongside appropriate molecular weight markers. Commercial preparations typically achieve >90% purity as determined by SDS-PAGE.

  • Western blotting: Use anti-His antibodies to detect the N-terminal His-tagged protein or specific antibodies against Apocytochrome f.

  • Mass spectrometry: Confirm the exact molecular weight and potential post-translational modifications.

  • UV-visible spectroscopy: Examine the characteristic absorption spectrum of the heme-containing protein, particularly if assessing functional integrity.

  • Activity assays: If studying electron transfer capabilities, employ redox potential measurements or functional reconstitution assays.

Always document batch variation by maintaining records of these quality control measures for experimental reproducibility .

What are the methodological considerations when comparing recombinant Apocytochrome f from different Solanum species?

When comparing recombinant Apocytochrome f from different Solanum species (e.g., S. tuberosum vs. S. bulbocastanum), researchers should employ a structured comparative analysis methodology:

  • Sequence alignment analysis: Despite high sequence conservation (the AA sequences provided for both species are identical in the search results), researchers should verify and document any amino acid differences that may exist in their specific constructs.

  • Expression system standardization: Use identical expression systems, purification methods, and tags (e.g., N-terminal His-tag) for all compared proteins to minimize system-based variations.

  • Structural characterization: Employ circular dichroism, X-ray crystallography, or protein NMR to detect subtle structural differences that may not be apparent from sequence data alone.

  • Functional comparison: Develop standardized electron transfer assays or reconstitution systems to quantitatively compare functional parameters.

  • Thermal stability analysis: Compare thermal denaturation profiles using differential scanning calorimetry or thermal shift assays to identify stability differences.

Document all methodological parameters meticulously to ensure valid cross-species comparisons and to identify true biological differences versus experimental artifacts .

How can researchers optimize functional reconstitution of recombinant Apocytochrome f into artificial membrane systems?

Optimizing functional reconstitution of recombinant Apocytochrome f into artificial membrane systems requires a methodical approach:

  • Preparation of liposomes or nanodiscs: Use lipid compositions that mimic the thylakoid membrane (phosphatidylcholine, phosphatidylglycerol, and monogalactosyldiacylglycerol at appropriate ratios).

  • Protein-to-lipid ratio optimization: Test a range of protein-to-lipid ratios (typically 1:100 to 1:1000 by weight) to determine optimal incorporation without aggregation.

  • Detergent removal methods:

    • Gradual dialysis against detergent-free buffer

    • Adsorption onto Bio-Beads SM-2

    • Gel filtration chromatography

  • Cofactor incorporation: Ensure proper incorporation of heme cofactors before or during reconstitution process.

  • Verification of insertion: Use protease protection assays, fluorescence quenching, or electron microscopy to confirm proper membrane insertion and orientation.

  • Functional validation: Measure electron transfer capabilities using artificial electron donors and acceptors, comparing activity to theoretical values based on protein concentration.

Document reconstitution efficiency to normalize activity measurements and enable meaningful comparisons between experimental conditions .

What are the current methodological approaches for studying protein-protein interactions between recombinant Apocytochrome f and other components of the photosynthetic electron transport chain?

For studying protein-protein interactions between recombinant Apocytochrome f and other photosynthetic electron transport chain components, researchers can employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant Apocytochrome f to pull down interaction partners from thylakoid membrane preparations.

  • Surface Plasmon Resonance (SPR): Immobilizing His-tagged Apocytochrome f on a sensor chip and measuring binding kinetics of putative interaction partners.

  • Microscale Thermophoresis (MST): Detecting interactions based on changes in thermophoretic mobility when complexes form.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifying protein regions involved in interactions through differential solvent accessibility.

  • Chemical Cross-linking followed by Mass Spectrometry (XL-MS): Stabilizing transient interactions through chemical cross-linking prior to analysis.

  • Förster Resonance Energy Transfer (FRET): Measuring energy transfer between fluorescently labeled proteins to determine proximity and orientation.

  • Cryo-Electron Microscopy: Visualizing intact protein complexes in near-native states to determine structural relationships.

What are common challenges in maintaining the functional integrity of recombinant Apocytochrome f during purification and storage?

Maintaining functional integrity of recombinant Apocytochrome f during purification and storage presents several challenges that can be addressed through specific methodological strategies:

  • Heme incorporation: Ensure proper heme incorporation during expression by supplementing growth media with δ-aminolevulinic acid (0.5-1 mM) to promote heme biosynthesis.

  • Oxidation susceptibility: Add reducing agents (0.5-1 mM DTT or 2-5 mM β-mercaptoethanol) to purification buffers to prevent oxidation of critical cysteine residues, particularly those involved in heme coordination.

  • Aggregation prevention: Include low concentrations (5-10%) of glycerol in purification buffers and slightly increase ionic strength (150-200 mM NaCl) to reduce aggregation tendencies.

  • Storage stability: For long-term storage, aliquot protein and store at -80°C with 50% glycerol as cryoprotectant. Alternatively, lyophilization with 6% trehalose as stabilizer may maintain protein structure during freeze-drying.

  • Activity monitoring: Develop a rapid spectroscopic assay to regularly verify redox activity before experimental use.

Implementing these strategies while documenting batch-to-batch variations will help ensure consistent protein quality throughout research projects .

What approaches can be used to study the differential expression of petA gene in various potato cultivars under different environmental stresses?

To study differential expression of the petA gene across potato cultivars under environmental stresses, researchers should employ this multifaceted approach:

  • Experimental design considerations:

    • Include diverse potato cultivars (e.g., pigmented varieties like purple HJG and red RR, alongside non-pigmented varieties like JZS8)

    • Apply standardized stress conditions (drought, salinity, temperature extremes) with appropriate controls

    • Collect samples at multiple time points to capture expression dynamics

  • RNA extraction optimization:

    • Use specialized protocols for plant tissues high in polysaccharides and polyphenols

    • Include additional purification steps such as LiCl precipitation

    • Assess RNA quality (RIN > 8) before proceeding to expression analysis

  • Expression analysis methodology:

    • RT-qPCR with carefully selected reference genes (validated for stability under stress conditions)

    • RNA-seq for genome-wide expression context

    • Consider using the PCAtools package for principal component analysis to visualize sample separation as demonstrated in the transcriptomic study of potato cultivars

  • Data validation approaches:

    • Confirm key findings with secondary methods (Northern blotting)

    • Correlate transcript levels with protein abundance using Western blotting

    • Validate biological reproducibility across growing seasons

This approach allows for robust analysis of environmental effects on petA expression while controlling for cultivar-specific responses .

How can CRISPR-Cas9 gene editing be applied to study the function of Apocytochrome f in potato chloroplasts?

Applying CRISPR-Cas9 gene editing to study Apocytochrome f function in potato chloroplasts requires specialized approaches due to the chloroplast location of the petA gene:

  • Targeting strategy options:

    • Indirect nuclear-encoded approach: Target nuclear genes regulating petA expression or proteins interacting with Apocytochrome f

    • Direct chloroplast transformation: Develop chloroplast-specific CRISPR-Cas9 systems with chloroplast transit peptide-tagged Cas9

  • Guide RNA design considerations:

    • Select target sites unique to petA to avoid off-target effects

    • Design guide RNAs with optimal GC content (40-60%) and minimal secondary structure

    • Consider using paired nickase approach to increase specificity

  • Transformation methodology:

    • For nuclear transformation: Agrobacterium-mediated delivery of CRISPR components

    • For chloroplast transformation: Biolistic delivery of plastid-targeted constructs

    • Screen transformed plants using heteroduplex mobility assays or T7E1 assays

  • Functional analysis of edited plants:

    • Characterize photosynthetic efficiency using PAM fluorometry

    • Measure electron transport rates through the cytochrome b6f complex

    • Assess growth phenotypes under different light intensities

  • Complementation studies:

    • Reintroduce wild-type or modified petA variants to confirm phenotypic rescue

    • Use inducible promoters to control timing of complementation

This approach allows for precise dissection of Apocytochrome f function in its native chloroplast environment while overcoming challenges specific to chloroplast genome manipulation .

What strategies can be employed for developing antibodies against specific epitopes of Solanum tuberosum Apocytochrome f for advanced immunological studies?

For developing antibodies against specific epitopes of Solanum tuberosum Apocytochrome f, researchers should implement these strategic approaches:

  • Epitope selection methodology:

    • Conduct computational analysis of the full amino acid sequence (YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQVLANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKTNILVVGPVPGKKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVSKIIRKEKGGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF) to identify:

      • Surface-exposed regions with high antigenicity scores

      • Regions showing sequence divergence from other cytochromes (for specificity)

      • Functional domains for domain-specific antibodies (e.g., heme-binding regions)

  • Antibody development options:

    • Synthetic peptide approach: Generate 15-20 amino acid peptides from selected epitopes

    • Recombinant fragment approach: Express specific domains as separate recombinant proteins

    • Full-length protein approach: Use the His-tagged recombinant protein available commercially

  • Production platform selection:

    • Monoclonal antibodies: For highest specificity to single epitopes

    • Polyclonal antibodies: For broader coverage of multiple epitopes

    • Recombinant antibodies: For specialized applications requiring defined properties

  • Validation methodology matrix:

    Validation MethodPrimary PurposeAcceptance Criteria
    Western BlotSpecificitySingle band at expected MW (36 kDa)
    ELISASensitivityDetection limit < 10 ng/mL
    ImmunoprecipitationFunctional binding> 80% target pull-down
    ImmunofluorescenceNative recognitionChloroplast-specific localization
  • Advanced applications testing:

    • Super-resolution microscopy compatibility

    • ChIP-sequencing suitability for protein-DNA interactions

    • Proximity labeling applications (BioID or APEX)

This comprehensive approach ensures development of highly specific antibodies suitable for diverse applications in photosynthesis research .

How might comparative analysis of Apocytochrome f across different Solanum species contribute to understanding evolutionary adaptations in photosynthetic efficiency?

Comparative analysis of Apocytochrome f across Solanum species offers valuable insights into evolutionary adaptations in photosynthetic efficiency through these methodological approaches:

  • Phylogenetic analysis framework:

    • Construct comprehensive phylogenetic trees based on petA sequences from diverse Solanum species

    • Identify signature amino acid substitutions in lineages adapted to different environmental niches

    • Calculate selection pressures (dN/dS ratios) to identify sites under positive selection

  • Structure-function correlation methodology:

    • Map sequence variations onto 3D structural models of Apocytochrome f

    • Focus analysis on regions involved in:

      • Electron transfer efficiency

      • Protein-protein interactions with plastocyanin

      • Stability under temperature extremes

    • Perform in silico mutagenesis to predict functional impacts of natural variations

  • Experimental validation approaches:

    • Express recombinant Apocytochrome f variants from species adapted to different environments

    • Measure electron transfer kinetics using standardized in vitro assays

    • Perform complementation studies in model systems with knocked-out endogenous petA

  • Integration with ecological data:

    • Correlate sequence variations with habitat parameters (light intensity, temperature ranges)

    • Test for associations between specific Apocytochrome f variants and photosynthetic efficiency metrics in natural populations

This integrated approach would reveal how evolutionary pressures have shaped this critical photosynthetic component across the Solanum genus, potentially identifying adaptive mechanisms relevant to crop improvement .

What potential applications exist for engineered variants of recombinant Apocytochrome f in synthetic biology and bioenergetics?

Engineered variants of recombinant Apocytochrome f offer numerous applications in synthetic biology and bioenergetics, approachable through these methodological frameworks:

  • Enhanced photosynthetic efficiency systems:

    • Engineer variants with optimized electron transfer rates by modifying heme coordination environment

    • Design Apocytochrome f variants with reduced susceptibility to photoinhibition

    • Create chimeric proteins incorporating functional domains from thermophilic organisms for improved stability

  • Biosensor development methodology:

    • Exploit the redox properties of Apocytochrome f to develop electron transfer-based biosensors

    • Engineer fusion proteins containing recognition domains for specific analytes alongside the electron transfer functionality of Apocytochrome f

    • Couple redox changes to reporter systems for visible/measurable outputs

  • Artificial photosynthesis components:

    • Incorporate engineered Apocytochrome f variants into electrode surfaces for bio-hybrid solar cells

    • Optimize immobilization strategies to maximize electron transfer to artificial acceptors

    • Design minimal electron transport chains incorporating optimized Apocytochrome f for hydrogen production

  • Biopharmaceutical applications potential:

    • Investigate redox-active domains for therapeutic applications targeting cellular redox imbalances

    • Develop protein scaffolds based on the stable structural elements of Apocytochrome f

  • Educational model systems:

    • Create simplified photosynthetic modules incorporating recombinant Apocytochrome f for teaching and demonstration purposes

Each application area requires specific protein engineering approaches, from directed evolution to rational design based on structural insights, with potential to address energy production challenges in sustainable systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.