Recombinant Solanum tuberosum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast ATP Synthase

ATP synthase subunit a (atpI) is integral to the F₀ sector, enabling proton translocation across the thylakoid membrane to drive ATP synthesis . Key functional insights:

  • Proton Transport: Forms a hydrophilic pathway for H⁺ movement, coupled with subunit c (atpH) .

  • Complex Stability: Interaction with the β-subunit (atpB) is essential for CF₀F₁ assembly .

  • Photosynthetic Impact: Knockdown of atpI reduces ATP synthase abundance, impairing photophosphorylation and CO₂ fixation .

3.1. Photosynthesis Studies

  • Viral Protein Interactions: Potato virus Y HC-Pro binds the β-subunit (atpB), reducing ATP synthase levels by 16% and impairing photosynthesis .

  • Stress Responses: Overexpression of transcription factors like StWRKY6 upregulates ATP synthase activity, enhancing cadmium tolerance .

3.2. Bioreactor Development

  • High-Yield Protein Production: RNAi-mediated knockdown of ATP/ADP transporters in S. tuberosum increases soluble protein content by 50%, enabling recombinant atpI scalability .

Comparative Analysis of ATP Synthase Subunits

Recombinant subunits of S. tuberosum ATP synthase (available for research) :

SubunitGeneRoleHost SystemPurity
atpIatpIF₀ proton channelE. coli/Cell-free≥85%
atpBatpBCF₁ catalytic β-subunitE. coli/Yeast≥85%
atpEatpECF₁ epsilon subunit (inhibitor)Mammalian cells≥85%

Challenges and Innovations

  • Stability Issues: Repeated freeze-thaw cycles degrade atpI; glycerol (50%) is recommended for long-term storage .

  • Transcriptional Regulation: Custom PPR proteins enable targeted atpI mRNA cleavage, enabling reverse genetics in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your specific requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during the production process. If a specific tag type is required, please inform us to prioritize its inclusion in the manufacturing process.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: sot:4099857

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpI) in Solanum tuberosum chloroplasts?

ATP synthase subunit a (atpI) is a critical membrane-embedded component of the chloroplastic ATP synthase complex in Solanum tuberosum (potato). This subunit forms part of the membrane-embedded F₀ sector that facilitates proton translocation across the thylakoid membrane. The protein contains multiple transmembrane helices that form the proton channel, essential for converting the proton gradient generated during photosynthesis into mechanical energy that drives ATP synthesis.

Unlike some other ATP synthase components, atpI is encoded by the chloroplast genome rather than nuclear DNA, highlighting its evolutionary conservation and importance . The protein functions in close coordination with other ATP synthase subunits, particularly the peripheral stalk subunits AtpF and ATPG, which are essential for stable assembly and function of the complex .

How does atpI differ from other ATP synthase subunits in structure and function?

The atpI subunit (subunit a) differs significantly from other ATP synthase subunits in several aspects:

  • Membrane topology: Unlike the centrally located gamma subunit (AtpC), which extends from the membrane F₀ portion into the F₁ catalytic head, atpI is entirely embedded within the membrane and contains multiple transmembrane helices .

  • Genetic origin: While some ATP synthase components like AtpG are nuclear-encoded, atpI is encoded by the chloroplast genome, reflecting its endosymbiotic bacterial origin .

  • Function: atpI forms the critical proton channel necessary for transmembrane proton movement, whereas other subunits like AtpC (gamma) are involved in mechanical energy transduction and catalytic site conformation changes .

  • Assembly requirements: The atpI subunit requires specific chaperones and assembly factors distinct from those needed for soluble ATP synthase components. It depends on coordinated biogenesis processes that involve both plastid and nuclear genetic systems .

  • Conservation: The atpI subunit shows high conservation across photosynthetic organisms due to its critical role in maintaining the proton gradient necessary for ATP synthesis .

What expression systems are most suitable for recombinant production of chloroplastic atpI?

For recombinant production of the chloroplastic atpI protein from Solanum tuberosum, researchers should consider several expression systems, each with distinct advantages:

  • Escherichia coli-based systems: While commonly used for recombinant protein production, E. coli systems often struggle with membrane proteins like atpI. When using E. coli, consider:

    • Using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Employing fusion partners (MBP, SUMO) to enhance solubility

    • Expressing in a cell-free system derived from E. coli

  • Chloroplast transformation systems: Direct expression in chloroplasts of model organisms like Chlamydomonas reinhardtii can provide native-like conditions for proper folding and assembly .

  • Insect cell systems: Baculovirus-infected insect cells provide eukaryotic processing capabilities and better membrane protein folding machinery.

  • Plant-based expression: Transient expression in Nicotiana benthamiana using viral vectors can yield functional chloroplast proteins with proper post-translational modifications.

The most suitable system depends on research goals, with E. coli being preferable for structural studies requiring high yield, while chloroplast-based systems are better for functional studies requiring proper assembly into the ATP synthase complex .

What strategies address the challenges of membrane protein purification for atpI?

Purification of membrane proteins like Solanum tuberosum atpI presents significant challenges that require specialized approaches:

  • Detergent selection: Screen multiple detergents to identify optimal solubilization conditions. Start with mild detergents like DDM (n-dodecyl β-D-maltoside) or digitonin that preserve protein structure and function.

  • Two-phase purification protocol:

    • Initial solubilization with stronger detergents (1-2% SDS or Triton X-100)

    • Followed by detergent exchange to milder conditions during column chromatography

  • Affinity tags optimization: Position tags carefully to avoid interference with transmembrane domains. C-terminal tags often outperform N-terminal tags for membrane proteins.

  • Amphipol substitution: Replace detergents with amphipathic polymers like A8-35 during later purification stages to enhance stability.

  • Lipid supplementation: Add specific lipids during purification to maintain native-like environment, particularly phosphatidylglycerol and monogalactosyldiacylglycerol, which are abundant in thylakoid membranes.

For atpI specifically, maintaining its association with other F₀ components during purification may enhance stability and functional relevance. Use gentle purification conditions and consider co-expression with interacting partners like AtpF (subunit b) .

How can researchers verify proper folding and functionality of recombinant atpI?

Verifying proper folding and functionality of recombinant Solanum tuberosum atpI requires multiple complementary approaches:

  • Immunological detection: Use antibodies against conserved epitopes of atpI to confirm expression. Western blotting with appropriate controls can verify size and expression level .

  • Membrane integration assessment:

    • Carbonate extraction assay to distinguish peripheral from integral membrane proteins

    • Protease protection assays to determine membrane topology

    • Sucrose gradient fractionation to confirm membrane association

  • Spectroscopic analysis:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content expected for a multi-helix membrane protein

    • Fluorescence spectroscopy with environmentally sensitive probes to assess tertiary structure

  • Functional reconstitution:

    • Liposome reconstitution with purified components to measure proton translocation

    • Assembly with other ATP synthase components to assess complex formation

    • ATP synthesis assays in reconstituted systems to confirm functional activity

  • Complementation assays: Introduce the recombinant protein into mutant systems lacking functional atpI (such as Chlamydomonas reinhardtii ATP synthase mutants) to test for restoration of function .

The combination of these approaches provides robust verification of both structural and functional integrity of the recombinant protein.

What is the role of atpI in coordinating nuclear and chloroplast-encoded components of ATP synthase?

The atpI subunit plays a crucial role in the coordinated biogenesis of ATP synthase, which contains components encoded by both chloroplast and nuclear genomes:

  • Assembly nucleation: atpI serves as an early assembly point for the membrane F₀ sector, creating a scaffold for subsequent incorporation of other subunits.

  • Signal integration: The expression and assembly of atpI responds to both plastid signals (redox state, ATP/ADP ratio) and nuclear-derived signals, facilitating coordinated biogenesis of the entire complex.

  • Stoichiometric regulation: Proper assembly of atpI is monitored by quality control systems that adjust expression of nuclear-encoded components to maintain optimal stoichiometry.

  • Co-translational assembly: Evidence suggests that atpI may assemble with other chloroplast-encoded subunits co-translationally, creating subassemblies that later integrate nuclear-encoded components .

  • Proteolytic regulation: The accumulation of ATP synthase subunits appears to be regulated by thylakoid proteases like FTSH1, which monitor proper assembly and degrade unpaired subunits, ensuring coordinated biogenesis .

Research in Chlamydomonas reinhardtii has demonstrated that defects in peripheral stalk subunits like AtpF and ATPG prevent proper ATP synthase assembly and accumulation, indicating the importance of coordinated expression and assembly of all components including atpI .

How do mutations in atpI impact ATP synthase assembly and photosynthetic efficiency?

Mutations in the atpI gene of Solanum tuberosum can have profound effects on ATP synthase assembly and photosynthetic efficiency, with the severity depending on the nature and location of the mutation:

  • Transmembrane domain mutations: Alterations in the membrane-spanning regions typically have the most severe consequences:

    • Disruption of proton channel function

    • Prevention of proper membrane integration

    • Destabilization of interactions with other F₀ components

  • Consequences for ATP synthase assembly:

    • Frame-shift mutations in membrane components like AtpF have been shown to completely prevent ATP synthase accumulation and function

    • Similar effects would be expected for severe atpI mutations

    • Missense mutations may allow partial assembly but with compromised function

  • Effects on photosynthetic efficiency:

    • Reduced ATP production limits carbon fixation capacity

    • Proton gradient disruption affects thylakoid lumen pH and electron transport

    • Compensatory upregulation of cyclic electron flow may occur

  • Protein degradation responses:

    • Unassembled or misfolded ATP synthase components become substrates for proteases

    • FTSH proteases have been identified as key regulators of ATP synthase subunit accumulation

    • Impaired atpI likely triggers increased degradation of other ATP synthase components

  • Phenotypic manifestations:

    • High sensitivity to fluctuating light conditions

    • Reduced growth under high light intensity

    • Altered thylakoid membrane organization

The specific effects of atpI mutations can be studied using CRISPR-Cas9 gene editing of the chloroplast genome, similar to approaches used for other ATP synthase components .

What structural analysis techniques are most effective for studying atpI topology and interactions?

Due to the complex membrane topology of atpI, combining multiple structural analysis techniques provides the most comprehensive understanding:

  • Cryo-electron microscopy (cryo-EM):

    • Most powerful for resolving membrane protein structures in near-native states

    • Can capture atpI within the context of the complete ATP synthase complex

    • Sample preparation challenges include:

      • Detergent selection to maintain native structure

      • Grid optimization to avoid preferential orientation

      • Particle heterogeneity management

  • Crosslinking mass spectrometry (XL-MS):

    • Identifies interacting regions between atpI and other ATP synthase components

    • Various crosslinkers with different spacer lengths can map the spatial relationships

    • Data analysis requires specialized software to identify crosslinked peptides

  • Site-directed spin labeling with EPR spectroscopy:

    • Provides information about the dynamic properties of specific regions

    • Particularly valuable for mapping conformational changes during proton translocation

    • Requires strategic introduction of cysteine residues for spin label attachment

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent-accessible regions and dynamics of protein structure

    • Particularly useful for identifying boundaries between membrane and soluble domains

    • Technical challenges include back-exchange during analysis

  • Molecular dynamics simulations:

    • Complements experimental approaches by predicting dynamic behavior

    • Particularly valuable for modeling proton translocation through the atpI channel

    • Requires experimental validation of key predictions

The most effective approach combines lower-resolution techniques that capture the whole complex (cryo-EM) with higher-resolution techniques that provide specific interaction details (XL-MS, HDX-MS) .

How does recombinant atpI interact with inositol pyrophosphate signaling pathways in chloroplasts?

Recent research suggests intriguing connections between ATP synthase function and inositol pyrophosphate signaling in chloroplasts, with potential implications for atpI:

  • Metabolic sensing and regulation:

    • Inositol pyrophosphates (PP-InsPs) function as energetic and metabolic sensors in plants

    • ATP synthase activity influences ATP/ADP ratios that affect PP-InsP metabolism

    • The atpI subunit may be regulated by these signaling pathways during stress responses

  • Enzymatic connections:

    • VIH kinases and ITPKs mediate synthesis of inositol pyrophosphates in plants

    • These enzymes respond to changes in ATP levels that are directly influenced by ATP synthase function

    • The reversible phosphotransfer activity of plant ITPKs may be coupled to ATP synthase activity

  • Phosphate starvation responses:

    • Inositol pyrophosphates are master regulators of phosphate starvation responses

    • ATP synthase regulation under phosphate limitation may involve signaling through these molecules

    • atpI expression or post-translational modification could be influenced by this pathway

  • Potential protein interactions:

    • PP-InsPs can non-enzymatically pyrophosphorylate proteins, potentially including ATP synthase components

    • Recombinant atpI could be used to investigate potential direct interactions with inositol pyrophosphates

    • In vitro reconstitution systems can test functional effects of these interactions

  • Research methodology:

    • Co-immunoprecipitation with tagged atpI followed by metabolite analysis

    • Reconstitution of purified components to test direct effects of PP-InsPs on proton translocation

    • Metabolomics approaches similar to those used in potato tuber analysis could reveal correlations between ATP synthase activity and inositol pyrophosphate levels

This emerging area represents a frontier in understanding how energy production through ATP synthase is integrated with broader metabolic signaling networks in plant chloroplasts .

What are the optimal conditions for expressing and purifying functional recombinant atpI?

The following optimized protocol represents a synthesis of approaches for successful recombinant atpI production:

Expression System Selection:

  • E. coli C41(DE3) strain with pET-based vectors for initial screening

  • Codon optimization for E. coli usage while preserving critical folding elements

  • Alternate systems: wheat germ cell-free expression for higher functionality

Expression Conditions:

  • Induction at lower temperatures (16-18°C) for 16-20 hours

  • IPTG concentration: 0.1-0.3 mM (higher concentrations often reduce yield)

  • Supplementation with 5% glycerol and 0.5% glucose to stabilize membranes

Extraction and Solubilization:

DetergentConcentrationAdvantagesBest Used For
DDM1-1.5%Mild, preserves activityInitial extraction
Digitonin1-2%Preserves complex interactionsComplex integrity studies
LMNG0.5-1%High stabilityLong-term storage
SMA copolymer2.5%Extracts native lipid environmentNative state studies

Purification Strategy:

  • Metal affinity chromatography with extended (30-40 mM imidazole) wash steps

  • Size exclusion chromatography in 0.05% DDM or 0.01% LMNG

  • Optional ion exchange step to remove contaminants

Stabilization Approaches:

  • Addition of 0.1-0.2 mg/ml soybean lipids or synthetic thylakoid lipid mixture

  • Inclusion of 10% glycerol and 100 mM NaCl in all buffers

  • Storage at -80°C after flash-freezing in small aliquots

This approach balances the need for sufficient yield with maintaining the native-like structure required for functional studies of atpI .

How can researchers design experiments to study atpI's role in proton translocation?

Investigating the proton translocation function of atpI requires specialized experimental approaches:

  • Liposome reconstitution assays:

    • Reconstitute purified atpI (alone or with other F₀ components) into liposomes

    • Create a pH gradient using acid-base transitions or light-driven proton pumps

    • Monitor pH changes using:

      • pH-sensitive fluorescent dyes (ACMA, pyranine)

      • pH electrodes for bulk measurements

      • Single-vesicle imaging for heterogeneity analysis

  • Site-directed mutagenesis studies:

    • Target conserved residues in predicted proton channel

    • Common targets include:

      • Charged residues (Arg, Glu) in transmembrane regions

      • Conserved polar residues (Ser, Thr) that may form hydrogen bonds

    • Assay mutant effects on proton translocation and ATP synthesis

  • Patch-clamp electrophysiology:

    • Giant unilamellar vesicles (GUVs) containing reconstituted atpI

    • Direct measurement of proton currents under voltage control

    • Pharmacological interventions with known inhibitors (oligomycin, venturicidin)

  • Hydrogen-deuterium exchange coupled to mass spectrometry:

    • Maps dynamic regions involved in proton transport

    • Identifies water-accessible channels within the protein structure

    • Reveals conformational changes during proton translocation

  • Computational approaches:

    • Molecular dynamics simulations of proton movement through atpI channel

    • pKa calculations of key residues in different conformational states

    • Prediction of water wire formation for Grotthuss-type proton transfer

These complementary approaches provide a comprehensive understanding of how atpI facilitates proton movement to drive ATP synthesis in the chloroplast ATP synthase complex .

What analytical methods best characterize atpI interactions with other ATP synthase components?

Characterizing the interactions between recombinant atpI and other ATP synthase components requires specialized analytical approaches:

  • Native gel electrophoresis systems:

    • Blue native PAGE (BN-PAGE) preserves native protein-protein interactions

    • Clear native PAGE with mild detergents for activity staining

    • 2D systems (BN-PAGE followed by SDS-PAGE) to identify complex components

  • Quantitative interaction analysis:

    • Microscale thermophoresis (MST) for measuring binding affinities in solution

    • Surface plasmon resonance (SPR) with carefully oriented atpI immobilization

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Co-immunoprecipitation approaches:

    • Anti-AtpC (gamma subunit) antibodies can pull down intact ATP synthase complexes

    • Sequential epitope tag strategies to verify specific interactions

    • Label-free quantitative proteomics to identify all interacting partners

  • Proximity labeling methods:

    • APEX2 or BioID fusions to atpI for in vivo identification of transient interactors

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange to identify protected regions upon complex formation

  • Fluorescence-based approaches:

    • Förster resonance energy transfer (FRET) between labeled ATP synthase components

    • Fluorescence correlation spectroscopy (FCS) to measure complex formation kinetics

    • Single-molecule tracking in reconstituted membrane systems

These methods can be applied in a complementary manner, with biochemical approaches establishing basic interactions and biophysical methods providing detailed quantitative parameters. This multi-method approach is particularly important when studying membrane proteins like atpI, where traditional interaction analysis can be challenging .

What emerging technologies will advance atpI research in the coming years?

Several cutting-edge technologies promise to transform research on Solanum tuberosum ATP synthase subunit a (atpI) in the near future:

  • Cryo-electron tomography of intact chloroplasts:

    • Visualizing ATP synthase in its native membrane environment

    • Mapping spatial distribution and organization within thylakoid membranes

    • Observing structural changes under different physiological conditions

  • Single-molecule functional techniques:

    • High-speed AFM to observe conformational dynamics in real-time

    • Single-molecule FRET to measure distance changes during catalytic cycle

    • Magnetic tweezers to directly measure force generation

  • Advanced gene editing in chloroplasts:

    • CRISPR-Cas9 systems optimized for chloroplast genome editing

    • Base editing technologies for precise single nucleotide modifications

    • Prime editing for scarless modifications without double-strand breaks

  • Artificial intelligence applications:

    • Improved protein structure prediction specifically for membrane proteins

    • Molecular dynamics simulations with quantum mechanical accuracy

    • Automated design of optimized recombinant expression systems

  • Synthetic biology approaches:

    • Minimal synthetic ATP synthase systems with defined components

    • Engineering ATP synthase for novel functions or improved efficiency

    • Biosensor development using modified ATP synthase components

These technologies will likely enable researchers to address fundamental questions about atpI structure, function, and regulation that have previously been technically challenging to investigate .

How can structural information about atpI inform engineering of more efficient photosynthetic systems?

Detailed structural and functional understanding of atpI offers significant opportunities for engineering enhanced photosynthetic efficiency:

  • Optimizing proton flow efficiency:

    • Structure-guided modifications to enhance proton translocation rates

    • Tuning the proton path to reduce slippage (proton movement without ATP production)

    • Engineering coordination between atpI and other ATP synthase components for improved coupling

  • Adapting to environmental conditions:

    • Engineering pH sensitivity to maintain function across diverse conditions

    • Modifying thermal stability for improved performance at temperature extremes

    • Designing variants with altered regulatory properties for specific environments

  • Applications in synthetic biology platforms:

    • Incorporating optimized atpI into minimal synthetic ATP synthesis systems

    • Creating hybrid systems with features from diverse photosynthetic organisms

    • Developing biosensors based on ATP synthase conformational changes

  • Improving crop photosynthetic efficiency:

    • Targeted modifications to potato atpI could enhance ATP production efficiency

    • Engineering reduced photorespiration through optimized ATP availability

    • Developing varieties with improved performance under fluctuating light conditions

  • Translational applications:

    • Bioinspired artificial photosynthetic systems for energy production

    • Nanoscale power generators based on ATP synthase principles

    • Therapeutic applications targeting homologous proteins in pathogens

The foundation for these applications depends on detailed knowledge of structure-function relationships in atpI, highlighting the importance of continued basic research in this area .

What are the key outstanding questions in atpI research that require interdisciplinary approaches?

Several critical questions about atpI remain unanswered and will require collaborative research across disciplines:

  • Proton translocation mechanism at atomic resolution:

    • Combining structural biology, computational chemistry, and biophysics

    • Mapping the complete proton path through the membrane domain

    • Understanding the energetics and kinetics of proton movement

  • Regulatory network integration:

    • How atpI expression and function integrate with cellular signaling networks

    • Potential connections to inositol pyrophosphate signaling pathways

    • Coordination between chloroplast and nuclear gene expression programs

  • Evolutionary adaptations across species:

    • Comparative genomics, structural biology, and biochemistry approaches

    • Understanding how atpI has evolved in different photosynthetic organisms

    • Identifying adaptations to diverse environmental conditions

  • Dynamic behavior during photosynthesis:

    • Real-time imaging in intact systems under changing light conditions

    • Integration with electron transport chain components

    • Responses to fluctuating proton motive force

  • Biotechnological applications:

    • Bioengineering, synthetic biology, and materials science collaborations

    • Development of ATP synthase-based nanomachines

    • Applications in bioenergy production systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.