Recombinant Solanum tuberosum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSQIVLNNIQEKSLLEKF RELEELLFLDEMIKEYSETHLEEFGIGIHKETIQLITIQNENRMDTILHFSTNIIWFGIL SGYSILGKEKLVILNSWAQEFLYNLSDTAKALCLLLVTEFFLGYHSPPGWEFAIRSIYNE VGVVANEQTITILVCILPVIFDTCFKYWLFRYLTSLSPSILLIYDSITE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: sot:4099989

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA in Solanum tuberosum and what are its fundamental characteristics?

The Chloroplast envelope membrane protein (cemA) in Solanum tuberosum (potato) is a membrane-bound protein localized in the chloroplast envelope. It is characterized by a full amino acid sequence of 229 amino acids which begins with MAKKKAFTPLFYLASIVFLPWWISFSVNK and continues through to SILLIYDSITE . According to UniProt database (entry Q2VEG5), cemA is a conserved protein involved in chloroplast function. The protein plays a crucial role in chloroplast envelope integrity and potentially in plastid-nucleus communication pathways that regulate gene expression patterns in response to environmental cues. Unlike many plant genes that have undergone duplication and diversification, cemA appears to be relatively conserved across species, suggesting functional importance within the chloroplast system.

What expression systems are most effective for producing recombinant cemA?

The optimal expression system for recombinant cemA production depends on research objectives and downstream applications. For structural studies requiring properly folded and functional protein, eukaryotic expression systems such as insect cells or yeast (Pichia pastoris) are often preferred due to their capacity to facilitate appropriate membrane protein folding and post-translational modifications. For high-yield applications where native folding is less critical, bacterial expression systems (particularly E. coli) utilizing vectors with strong inducible promoters can be employed with codon optimization for plant-derived sequences.

The expression region for cemA corresponds to amino acids 1-229, representing the full-length protein . When designing expression constructs, researchers should consider including purification tags that minimally interfere with protein function. The following table summarizes expression system considerations:

Expression SystemAdvantagesLimitationsRecommended For
E. coliHigh yield, cost-effective, rapid growthMay form inclusion bodies with membrane proteinsInitial screening, antibody production
Yeast (P. pastoris)Proper folding, high yield, scale-up potentialLonger production timeFunctional studies, structural analysis
Insect cellsNear-native folding, post-translational modificationsTechnical complexity, higher costDetailed functional characterization
Plant expression systemsNative post-translational modificationsLower yield, time-consumingIn planta interaction studies

What are the recommended storage and handling protocols for recombinant cemA?

Optimal preservation of recombinant cemA functionality requires careful attention to storage conditions. For long-term storage, the protein should be maintained at -20°C or preferably -80°C in a buffer containing stabilizing agents . The recommended buffer composition includes Tris-based buffer with 50% glycerol that has been optimized specifically for cemA stability . This high glycerol concentration prevents ice crystal formation during freezing, which could otherwise disrupt protein structure.

To minimize protein degradation, repeated freeze-thaw cycles should be strictly avoided . Instead, researchers should aliquot the purified protein into single-use volumes before freezing. For ongoing experiments, working aliquots can be stored at 4°C but should not be kept longer than one week to prevent degradation . Researchers should verify protein integrity by SDS-PAGE or functional assays before proceeding with critical experiments, particularly after extended storage periods.

How can researchers effectively design experiments to study cemA interactions with other chloroplast proteins?

Studying protein-protein interactions involving cemA requires methodological approaches tailored to membrane proteins. Co-immunoprecipitation (Co-IP) experiments should incorporate crosslinking agents suitable for membrane proteins, such as DSP (dithiobis(succinimidyl propionate)) or formaldehyde, prior to cell lysis. For in vitro binding studies, researchers should retain the native lipid environment or reconstitute cemA into liposomes to maintain native conformation.

Yeast two-hybrid systems have limitations for membrane proteins; therefore, split-ubiquitin membrane yeast two-hybrid (MYTH) systems or bimolecular fluorescence complementation (BiFC) assays are more appropriate. When designing BiFC experiments with cemA, researchers should carefully consider tag orientation to prevent interference with protein topology and membrane insertion.

A ChIP-qPCR approach, similar to that used successfully for StCDF1 protein in potato studies , can be adapted for cemA interaction studies when investigating potential DNA binding activities or associations with DNA-binding complexes. In such experiments, appropriate negative controls (such as actin gene regions) are essential for validating specific interactions .

What analytical techniques are most suitable for characterizing cemA structural properties?

The structural characterization of membrane proteins like cemA requires specialized techniques due to their hydrophobic nature and conformational dependence on the lipid environment. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure composition (α-helices, β-sheets) and can monitor structural changes under varying conditions.

For high-resolution structural determination, researchers should consider:

  • Cryo-electron microscopy: Particularly suitable for membrane proteins in detergent micelles or nanodiscs

  • X-ray crystallography: Requires extensive optimization of crystallization conditions with appropriate detergents

  • Nuclear magnetic resonance (NMR): Limited to specific domains due to size constraints

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides valuable information about protein dynamics and solvent-accessible regions

Computational modeling approaches can supplement experimental data. Homology modeling based on related proteins with known structures can generate initial structural hypotheses, while molecular dynamics simulations can predict conformational changes in response to different lipid environments or interaction partners.

How can researchers systematically investigate the function of cemA in chloroplast envelope dynamics?

Functional investigation of cemA requires a multi-faceted approach combining genetic manipulation, physiological measurements, and biochemical analyses. CRISPR/Cas9 gene editing can generate precise mutations or knockouts, though care must be taken when targeting chloroplast-related genes as they may impact plant viability. RNAi approaches similar to those used for StCDF1 in potato represent an alternative for reducing gene expression without complete elimination.

Researchers should perform detailed phenotypic characterization of cemA-modified plants under various environmental conditions, particularly assessing:

  • Photosynthetic efficiency (using chlorophyll fluorescence parameters)

  • Chloroplast ultrastructure (via transmission electron microscopy)

  • Membrane integrity (using fluorescent dyes)

  • Stress responses (particularly to light, temperature, and drought conditions)

Transcriptomic analysis should examine global expression changes following cemA modification, with particular attention to chloroplast-encoded genes and nuclear genes involved in retrograde signaling pathways. Proteomics approaches focusing on chloroplast envelope fractions can identify changes in protein composition or post-translational modifications affecting chloroplast function.

What controls should be incorporated when studying recombinant cemA in experimental systems?

Robust experimental design for cemA research requires comprehensive controls to ensure valid and interpretable results. For expression studies, empty vector controls and non-relevant protein expression controls (ideally with similar size and hydrophobicity) should be included. When performing localization studies, both positive controls (known chloroplast envelope proteins) and negative controls (proteins targeted to other cellular compartments) are essential.

For functional studies, researchers should include:

  • Wild-type controls subjected to identical experimental conditions

  • Complementation controls (cemA-deficient lines expressing wild-type cemA)

  • Dosage controls (expression at physiological levels versus overexpression)

  • Tissue-specific or inducible expression systems to distinguish direct from indirect effects

When conducting ChIP-qPCR experiments to investigate potential DNA interactions, researchers should follow established protocols that include pre-immunized serum as background control and unrelated genomic regions (such as actin) as negative controls, similar to approaches used in StCDF1 studies . Time-course experiments should include multiple timepoints to capture dynamic processes, particularly when investigating responses to environmental stimuli.

What are effective strategies for optimizing recombinant cemA protein yield and quality?

Optimizing recombinant cemA production requires systematic refinement of expression conditions and purification protocols. For E. coli expression systems, codon optimization based on E. coli codon usage bias can significantly enhance translation efficiency. Pilot experiments should test multiple expression strains (e.g., BL21(DE3), C41(DE3), Rosetta) optimized for membrane proteins.

Induction parameters critically impact protein quality and yield:

ParameterStrategyRationale
Induction temperatureLower temperatures (16-20°C)Reduces aggregation, improves folding
Inducer concentrationGradient testing (0.1-1.0 mM IPTG)Identifies optimal expression level
Induction timingMid-log phase (OD600 0.6-0.8)Balances biomass and expression capacity
Induction durationExtended periods (16-24 hours)Allows accumulation of properly folded protein

Extraction and purification should employ detergents optimized for chloroplast membrane proteins, such as n-dodecyl β-D-maltoside (DDM) or digitonin, which maintain native-like environments. For particularly challenging preparations, bicelles or nanodiscs can provide more native-like lipid environments while maintaining protein solubility.

How should researchers approach cemA mutation studies to correlate structure with function?

Structure-function studies of cemA should employ rational design principles based on evolutionary conservation and predicted structural features. Sequence alignment across multiple plant species can identify highly conserved residues likely essential for function. Hydropathy analysis can predict transmembrane domains and solvent-exposed regions that may participate in protein-protein interactions.

Mutation strategies should include:

  • Alanine scanning of conserved domains: Systematic replacement with alanine to identify functionally important residues

  • Domain swapping: Exchanging domains with homologs to determine functional boundaries

  • Targeted mutagenesis: Focusing on predicted functional sites (e.g., potential phosphorylation sites)

  • Terminal truncations: Removing portions to identify minimal functional units

Researchers must verify proper protein expression, localization, and folding for each mutant to distinguish between direct functional effects and artifacts of misfolding or mislocalization. Complementation experiments in knockout or knockdown plants provide the most compelling evidence for structure-function relationships, demonstrating whether mutated proteins can restore wild-type phenotypes.

How can researchers resolve conflicting results in cemA functional studies?

Conflicting results in cemA research may arise from methodological differences, genetic background variations, or environmental factors. When facing contradictory data, researchers should systematically evaluate potential sources of discrepancy by comparing experimental parameters across studies, including:

  • Genetic background (ecotype, cultivar, or transgenic line generation method)

  • Growth conditions (light intensity, photoperiod, temperature, humidity)

  • Developmental stage of analyzed tissues

  • Expression level and pattern of recombinant proteins

  • Analytical methods and their sensitivity

What statistical approaches are most appropriate for cemA expression analysis?

The statistical analysis of cemA expression data requires careful consideration of experimental design and data characteristics. For qRT-PCR data, researchers should adhere to MIQE guidelines (Minimum Information for Publication of Quantitative Real-Time PCR Experiments), including appropriate reference gene selection and validation. Multiple reference genes should be tested for stability across experimental conditions, with normalization using geometric means of the most stable references.

For differential expression analysis, researchers should:

  • Test data for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • Apply appropriate parametric (t-test, ANOVA) or non-parametric (Mann-Whitney, Kruskal-Wallis) tests

  • Correct for multiple comparisons (Bonferroni, Benjamini-Hochberg) when analyzing multiple genes or conditions

  • Report effect sizes alongside p-values to indicate biological significance

Time-course experiments, similar to those conducted for StFLORE expression analysis , require special consideration. Researchers can apply repeated measures ANOVA or mixed-effects models that account for time-dependent correlations. For complex experimental designs with multiple factors, multivariate analysis techniques such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can identify patterns and relationships between variables.

How can researchers effectively distinguish between direct and indirect effects in cemA functional studies?

Distinguishing direct from indirect effects in complex biological systems requires experimental designs that establish causality. Inducible expression systems allow temporal control over cemA expression or modification, enabling observation of immediate responses likely representing direct effects. Time-course experiments can reveal the sequence of events following cemA perturbation, with early responses typically representing more direct consequences.

ChIP-qPCR or ChIP-seq approaches, similar to those used for studying StCDF1 binding to target promoters , can identify direct binding interactions if cemA functions in transcriptional regulation complexes. For protein-protein interactions, in vitro binding assays with purified components provide the most direct evidence for physical interactions, though these should be complemented with in vivo approaches to confirm biological relevance.

Genetic epistasis experiments, where cemA modifications are combined with mutations in potential pathway components, can establish hierarchical relationships. If cemA acts upstream of another factor, the double mutant should phenocopy the downstream factor mutant. Comparative transcriptomics or proteomics across multiple genetic backgrounds can further illuminate pathway relationships and distinguish direct from indirect effects.

What are the emerging research frontiers in cemA biology?

The study of cemA in Solanum tuberosum represents a developing area within chloroplast biology research, with several promising directions for future investigation. Integration of multi-omics approaches (genomics, transcriptomics, proteomics, and metabolomics) will likely provide comprehensive understanding of cemA's role in chloroplast function and plant physiology. Emerging techniques such as proximity labeling (BioID, APEX) could reveal the complete interactome of cemA within its native membrane environment.

CRISPR/Cas9-mediated genome editing offers unprecedented opportunities for precise manipulation of cemA sequences in potato and other crop species. This may illuminate both fundamental biological roles and potential applications in crop improvement, particularly related to photosynthetic efficiency and stress tolerance. Similar approaches have proven valuable in studying other potato genes like StCDF1, which impacts both tuberization and drought tolerance .

Comparative analysis across diverse plant species may reveal how cemA function has evolved and diversified, potentially identifying specialized roles in different photosynthetic systems or environmental adaptations. These evolutionary insights could guide biomimetic approaches to engineering enhanced chloroplast function in crop species.

How can researchers integrate cemA studies into broader plant science contexts?

The integration of cemA research into larger plant science frameworks requires connecting chloroplast envelope function to whole-plant physiology and agricultural applications. Researchers should consider cemA's potential roles in retrograde signaling pathways that coordinate nuclear and chloroplast gene expression in response to environmental changes. This connects to broader research on plant stress responses and adaptation mechanisms.

Collaborative approaches linking molecular studies with physiological and agronomic research will be essential. For instance, understanding how cemA influences photosynthetic efficiency under varying light and temperature conditions could inform breeding strategies for climate resilience. Similar integrative approaches studying StCDF1 and StFLORE in potato have revealed connections between molecular mechanisms and agronomically important traits like tuberization timing and drought tolerance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.