Recombinant Solanum tuberosum Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Solanum tuberosum Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC) is a protein component of the cytochrome b6-f complex found in potato plants (Solanum tuberosum) . The cytochrome b6-f complex is essential for photosynthetic electron transport in the thylakoid membranes of chloroplasts . PetC, also known as the Rieske iron-sulfur protein, is a core subunit of this complex .

Function of Cytochrome b6-f Complex and PetC Subunit

The cytochrome b6-f complex mediates electron transfer between Photosystem II and Photosystem I, playing a crucial role in photosynthetic electron transport . This complex oxidizes plastoquinol and reduces plastocyanin, contributing to the generation of a proton gradient across the thylakoid membrane that drives ATP synthesis .

PetC (Rieske iron-sulfur protein) is a key component of the cytochrome b6-f complex, essential for its proper function . The Rieske iron-sulfur protein facilitates electron transfer within the complex . Overexpression of Rieske FeS in Nicotiana tabacum (tobacco) can lead to an increase in the abundance of the cytochrome b6-f complex, enhancing cytochrome f activity, which indicates the complex's full functionality .

Structure and Characteristics

PetC contains an iron-sulfur cluster, which is essential for its role in electron transfer . The protein is encoded by the nuclear petC gene . The full sequence of the potato chloroplast genome, including petC, has been determined and is used in expression analysis of plastid genes .

Role in Plant Stress Response

Manipulation of chloroplast electron distribution, potentially involving PetC, can increase plant tolerance to environmental challenges, including drought stress . Flavodoxin expression in potato chloroplasts can protect photosynthetic activities under water limitation, suggesting that modulating electron transport chain components like PetC could improve drought tolerance in crops .

Research and Applications

The study of PetC and the cytochrome b6-f complex is relevant to understanding and potentially enhancing photosynthesis and plant productivity . Research has shown that modifying the abundance of Rieske FeS protein can impact the electron transport rate in plants .

Antibody Information

AntibodyDescriptionHostClonalityApplications
Anti-PetCRieske iron-sulfur protein of Cyt b6/f complexRabbitPolyclonalBN-PAGE, WB

Note: BN-PAGE stands for Blue Native Polyacrylamide Gel Electrophoresis, and WB stands for Western blot .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-230
Protein Length
Full Length of Mature Protein
Species
Solanum tuberosum (Potato)
Target Names
petC
Target Protein Sequence
QALLVKPMKINGHGMGKDKRMKAKCMAASIPADDRVPDMEKRNLMNLLLLGALALPTGGM LVPYATFFAPPGSGGGSSGTIAKDANGNDVVVTEWLKTHSPGTRTLTQGLKGDPTYLVVE NDGTLATYGINAVCTHLGCVVPWNTAENKFICPCHGSQYNNQGKVVRGPAPLSLALAHAD IDDGKVVFVPWVETDFRTGDSPWWA
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does it play in Solanum tuberosum?

The cytochrome b6-f complex is a crucial membrane protein complex present in the thylakoid membranes of chloroplasts in Solanum tuberosum (potato). It functions as an electron transfer intermediate between photosystems II and I in the photosynthetic electron transport chain. The complex catalyzes the transfer of electrons from plastoquinol to plastocyanin while simultaneously pumping protons across the thylakoid membrane, contributing to the generation of the proton gradient necessary for ATP synthesis.

In potato plants, this complex is essential for normal photosynthetic function and energy production. Disruption of the cytochrome b6-f complex severely impairs photosynthetic efficiency, affecting plant growth and tuber development. Research has shown that mutations affecting components of this complex can reduce photosynthetic capacity by more than 90% in affected plants .

How is the structure of the Rieske iron-sulfur protein (petC) organized in the cytochrome b6-f complex?

The Rieske iron-sulfur protein (petC) is one of four major protein subunits comprising the cytochrome b6-f complex. It contains:

  • A membrane-anchoring N-terminal domain embedded in the thylakoid membrane

  • A soluble domain extending into the thylakoid lumen

  • A characteristic [2Fe-2S] cluster coordinated by two histidine and two cysteine residues

This [2Fe-2S] cluster serves as the initial electron acceptor from plastoquinol, making petC crucial for electron transport function. The protein domain containing the iron-sulfur cluster adopts a highly conserved tertiary structure across plant species, while the transmembrane domain shows more variation .

What methods are available for isolating the petC gene from Solanum tuberosum?

Several methodological approaches can be employed for isolating the petC gene from potato:

  • PCR-based isolation:

    • Design primers based on conserved regions of petC from related Solanaceae species

    • Extract genomic DNA from potato leaves using CTAB or commercial kits

    • Amplify the target sequence using touchdown PCR to accommodate potential mismatches

    • Verify amplicon identity through sequencing

  • cDNA library screening:

    • Prepare a cDNA library from potato leaf tissue under conditions that promote photosynthetic gene expression

    • Design probes based on published petC sequences

    • Perform colony/plaque hybridization to identify positive clones

    • Confirm identity through restriction digest patterns and sequencing

  • Genomic library screening:

    • Use potato-specific BAC libraries

    • Probe with labeled petC fragments

    • Verify positive clones through PCR and sequencing

For optimal results, researchers should select fresh, young leaf tissue harvested in the morning when chloroplast gene expression is highest .

What are the most effective methods for recombinant expression of Solanum tuberosum petC?

Effective recombinant expression of potato petC requires careful consideration of expression systems and protein targeting:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli (BL21-DE3)Rapid growth, high yield, simple manipulationImproper folding of Fe-S cluster, no post-translational modifications5-15 mg/L
Insect cells (Sf9)Better folding, some post-translational modificationsLonger production time, more expensive3-8 mg/L
Plant-based (N. benthamiana)Native-like modifications, proper foldingLower yields, longer production time1-3 mg/L

Methodological recommendations:

  • E. coli expression strategy:

    • Clone mature petC (without chloroplast transit peptide) into pET vectors

    • Co-express with iron-sulfur cluster assembly proteins (ISC system)

    • Express at lower temperatures (16-18°C) to improve folding

    • Include 0.1-0.5 mM ferric ammonium citrate and cysteine in medium

    • Purify under anaerobic conditions to preserve Fe-S cluster integrity

  • Plant-based expression strategy:

    • Use Agrobacterium-mediated transient expression

    • Target recombinant petC to chloroplasts using native transit peptide

    • Harvest 5-7 days post-infiltration

    • Isolate using gentle membrane solubilization (0.5-1% dodecyl maltoside)

    • Purify via affinity chromatography with polyhistidine tag

For optimal functional studies, the plant-based system is recommended despite lower yields, as it provides more native-like protein conformation and appropriate post-translational modifications.

How can researchers validate the functionality of recombinant petC in vitro?

Validating the functionality of recombinant petC requires multiple complementary approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to confirm characteristic absorption peaks of the [2Fe-2S] cluster (330, 458, and 560 nm)

    • Electron paramagnetic resonance (EPR) spectroscopy to verify redox properties of the Fe-S cluster

    • Circular dichroism to assess secondary structure integrity

  • Electron transfer assays:

    • Measure electron transfer rates using plastoquinol analogs as substrates

    • Monitor reduction of cytochrome f or artificial electron acceptors

    • Compare kinetic parameters (Km, Vmax) with native complex

  • Reconstitution experiments:

    • Incorporate recombinant petC into liposomes with other purified components

    • Measure proton pumping activity across the membrane

    • Assess electron transport chain functionality

Functionality validation requires a multi-faceted approach, as structural integrity alone does not guarantee proper electron transfer function.

What control experiments are essential when studying recombinant petC?

For rigorous scientific investigation of recombinant petC, include these essential controls:

  • Negative controls:

    • Expression vector without petC insert

    • Inactive petC mutant (e.g., mutation in Fe-S coordinating residues)

    • Denatured petC protein

  • Positive controls:

    • Native cytochrome b6-f complex isolated from potato chloroplasts

    • Well-characterized petC from model organisms (Arabidopsis, spinach)

    • Synthetic peptides corresponding to functional domains

  • Verification controls:

    • Western blot analysis with anti-petC antibodies

    • Mass spectrometry confirmation of protein identity

    • N-terminal sequencing to verify correct processing

    • Size-exclusion chromatography to assess oligomeric state

Control experiments should be performed under identical conditions as the test samples to ensure valid comparisons. Statistical analysis should include at least three biological replicates to account for variation in expression and purification.

How does petC expression vary across different potato tissues and developmental stages?

The expression of petC in Solanum tuberosum shows distinct tissue-specific and developmental patterns:

Tissue-Specific Expression Levels:

Tissue TypeRelative petC ExpressionChloroplast DensityPhotosynthetic Activity
Young leavesVery high (100%)HighHigh
Mature leavesHigh (80-90%)HighHigh
StemsModerate (40-60%)ModerateModerate
RootsVery low (5-10%)NoneNone
Tubers (skin)Low (15-25%)LowLow
Tubers (flesh)Very low (1-5%)Very lowVery low
FlowersModerate (30-50%)ModerateModerate

The expression pattern correlates with chloroplast development and photosynthetic activity. Young, developing leaves show the highest expression levels as they establish photosynthetic machinery. Expression is minimal in underground tissues like tuber flesh, which contains amyloplasts rather than chloroplasts .

Developmentally, petC expression increases dramatically during leaf expansion, plateaus during mature leaf function, and decreases during senescence. Environmental factors including light intensity, photoperiod, and temperature significantly modulate expression levels.

For accurate expression studies, researchers should:

  • Normalize expression data to multiple reference genes stable across tissues

  • Consider diurnal variations in sampling design

  • Account for environmental conditions that may affect photosynthetic gene expression

What approaches are recommended for studying the assembly of the cytochrome b6-f complex incorporating recombinant petC?

Studying cytochrome b6-f complex assembly with recombinant petC requires sophisticated biochemical and imaging approaches:

  • In vitro reconstitution studies:

    • Purify individual components (cytochrome b6, cytochrome f, subunit IV)

    • Combine with recombinant petC in detergent micelles or liposomes

    • Monitor assembly using analytical ultracentrifugation, native PAGE, or size-exclusion chromatography

    • Assess functional reconstitution through electron transfer assays

  • Fluorescence-based approaches:

    • Generate fluorescently tagged versions of all complex components

    • Use Förster resonance energy transfer (FRET) to monitor protein-protein interactions

    • Track assembly kinetics through time-resolved fluorescence

  • Genetic complementation:

    • Transform petC-deficient mutants with recombinant constructs

    • Assess rescue of photosynthetic phenotypes

    • Analyze complex assembly through immunoprecipitation and proteomics

  • Cryo-electron microscopy:

    • Visualize assembly intermediates at different stages

    • Determine structural changes during incorporation of petC

    • Map interaction interfaces at molecular resolution

Research from the Lemna perpusilla mutant (No. 1073) demonstrates that petC is critical for stable assembly of the complex. In this mutant, cytochrome f and subunit IV were synthesized but rapidly degraded due to the absence of petC, suggesting a key role for petC in stabilizing the entire complex. Assembly studies should therefore focus on the timing of petC incorporation and its effect on the stability of other subunits .

How can researchers troubleshoot issues with protein stability when working with recombinant petC?

Common stability issues with recombinant petC and their solutions include:

Problem: Iron-sulfur cluster degradation

  • Solution: Purify under anaerobic conditions using a glove box

  • Solution: Add reducing agents (2-5 mM DTT or β-mercaptoethanol)

  • Solution: Include iron and sulfur sources in purification buffers

  • Solution: Store at -80°C with 10% glycerol as cryoprotectant

Problem: Protein aggregation

  • Solution: Optimize detergent type and concentration (0.02-0.05% DDM usually optimal)

  • Solution: Include stabilizing agents (glycerol, sucrose, specific lipids)

  • Solution: Modify ionic strength (typically 150-300 mM NaCl is optimal)

  • Solution: Express as fusion with solubility-enhancing tags (MBP, SUMO)

Problem: Proteolytic degradation

  • Solution: Include protease inhibitor cocktail throughout purification

  • Solution: Reduce purification time through streamlined protocols

  • Solution: Perform purification at 4°C

  • Solution: Remove flexible, protease-susceptible regions based on structural predictions

Problem: Oxidative damage

  • Solution: Include antioxidants (ascorbate, glutathione)

  • Solution: Purge all buffers with nitrogen

  • Solution: Minimize exposure to light during purification

  • Solution: Use amber tubes for storage

Stability assessment should be performed using multiple methods including SDS-PAGE, native PAGE, size-exclusion chromatography, and activity assays at different time points and storage conditions.

What statistical approaches are most appropriate for analyzing petC expression data in transgenic potato lines?

When analyzing petC expression data from transgenic potato lines, researchers should implement these statistical approaches:

  • Data normalization strategies:

    • Geometric averaging of multiple reference genes (ACT, EF1α, GAPDH)

    • Use of ΔΔCt method for relative quantification

    • RPKM/FPKM normalization for RNA-seq data

    • Consider using URT (Universal Reference Target) for cross-study comparisons

  • Statistical tests for differential expression:

    • ANOVA with post-hoc tests for multi-group comparisons

    • Student's t-test (paired or unpaired) for two-group comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data

    • Linear mixed models for complex experimental designs with multiple variables

  • Multiple testing correction:

    • Benjamini-Hochberg procedure for false discovery rate control

    • Bonferroni correction for family-wise error rate control

    • q-value calculation for large-scale expression studies

  • Correlation analysis:

    • Pearson or Spearman correlation between petC expression and physiological parameters

    • Principal component analysis for multidimensional data reduction

    • Hierarchical clustering to identify co-expressed genes

How can researchers distinguish between effects caused by altered petC expression versus secondary metabolic changes?

Distinguishing direct effects of petC alteration from secondary metabolic responses requires carefully designed experiments and controls:

  • Time-course studies:

    • Monitor changes at multiple time points after petC induction/repression

    • Early changes (hours) are more likely direct effects

    • Later changes (days) often represent adaptive responses

  • Dose-response relationships:

    • Utilize inducible promoters to create varying levels of petC expression

    • Plot physiological parameters against petC protein levels

    • Direct effects typically show proportional relationships

  • Metabolic flux analysis:

    • Trace carbon flow using 13C-labeled substrates

    • Compare flux distributions between wild-type and petC-modified plants

    • Identify metabolic nodes with altered flux coefficients

  • Genetic complementation approaches:

    • Introduce compensatory mutations in related pathways

    • Assess whether they alleviate petC-associated phenotypes

    • Use CRISPR-Cas9 to create targeted knockouts in parallel pathways

  • Network analysis:

    • Construct gene co-expression networks

    • Identify modules directly connected to petC

    • Compare with known photosynthetic and metabolic networks

For experimental design, include carefully selected controls:

  • Wild-type plants under identical conditions

  • Plants with altered expression of non-electron transport proteins

  • Plants treated with specific electron transport inhibitors

By combining these approaches, researchers can build a causal model distinguishing primary molecular consequences of petC alteration from secondary metabolic adjustments.

What are the major challenges in analyzing structure-function relationships in recombinant versus native petC?

Analyzing structure-function relationships between recombinant and native petC presents several methodological challenges:

Major Structural Challenges and Analytical Solutions:

ChallengeAnalytical ApproachMethodological Considerations
Post-translational modificationsMass spectrometry (MS/MS)Use enrichment strategies for low-abundance modifications
Protein-lipid interactionsNative mass spectrometry, MD simulationsMaintain native lipid environment during purification
Fe-S cluster integrityEPR spectroscopy, X-ray absorptionCompare redox potentials between native and recombinant forms
Membrane integrationHydrogen-deuterium exchange MSMap solvent-accessible regions of membrane domains
Protein dynamicsNMR relaxation studies, smFRETCompare flexibility of key functional domains
Intersubunit interactionsCrosslinking MS, FRETAssess interaction strength with partner proteins

A comprehensive approach should include:

  • Comparative structural analysis:

    • Overlay crystal or cryo-EM structures of native and recombinant proteins

    • Calculate RMSD values for backbone atoms

    • Identify regions with significant structural deviations

  • Functional comparison:

    • Measure electron transfer rates under identical conditions

    • Determine midpoint potentials of the [2Fe-2S] cluster

    • Assess protein stability through thermal shift assays

    • Compare binding affinities for interaction partners

  • Molecular dynamics simulations:

    • Model protein behavior in membrane environments

    • Identify differences in conformational flexibility

    • Predict effects of observed structural differences on function

When publishing structure-function analyses, researchers should clearly report the expression system used, purification conditions, and reconstitution methods, as these significantly impact the final protein structure and activity .

How can CRISPR-Cas9 gene editing be effectively applied to modify petC in Solanum tuberosum?

CRISPR-Cas9 gene editing offers powerful approaches for studying and modifying petC in potato:

CRISPR-Cas9 Strategy for petC Modification:

  • Guide RNA (gRNA) design considerations:

    • Target exons encoding critical functional domains (Fe-S binding, membrane anchor)

    • Use potato-specific genome databases to ensure unique targeting

    • Design multiple gRNAs to increase editing efficiency

    • Avoid regions with high GC content (>70%) for better efficiency

    • Verify specificity using BLAST against the potato genome

  • Delivery methods for potato transformation:

    • Agrobacterium-mediated transformation of potato explants

    • PEG-mediated transformation of potato protoplasts

    • Biolistic bombardment for direct DNA delivery

  • Editing strategies:

    • Gene knockout: Target early exons to create frameshift mutations

    • Base editing: Use cytidine or adenine deaminase fusions for specific substitutions

    • Prime editing: Introduce precise edits without double-strand breaks

    • Homology-directed repair: Include repair template for specific sequence insertion

  • Screening and validation:

    • PCR-RE assay to detect loss of restriction sites

    • T7E1 assay to detect heteroduplex formation

    • Deep sequencing to quantify editing efficiency

    • Western blot analysis to confirm protein modification/elimination

    • Spectroscopic analysis to assess Fe-S cluster formation

  • Phenotypic analysis:

    • Chlorophyll fluorescence measurements (Fv/Fm, NPQ)

    • Photosynthetic electron transport rate determination

    • Growth analysis under various light intensities

    • Metabolite profiling to assess downstream effects

For successful CRISPR editing in potato, researchers should be aware that tetraploid commercial varieties contain four alleles of petC, requiring comprehensive screening to identify lines with modifications in all copies. Alternatively, consider working with diploid potato lines as described in recent breeding advances .

What are the latest techniques for studying electron transport dynamics in the context of modified petC?

Cutting-edge techniques for investigating electron transport dynamics in modified petC systems include:

  • Ultrafast spectroscopy approaches:

    • Femtosecond transient absorption spectroscopy to track electron movements

    • Time-resolved fluorescence to measure energy transfer steps

    • Pump-probe spectroscopy to determine electron transfer rates

    • 2D electronic spectroscopy for mapping energy transfer pathways

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational dynamics

    • Optical tweezers combined with fluorescence to correlate structure and function

    • Patch-clamp of reconstituted proteoliposomes to measure proton pumping

    • Atomic force microscopy to visualize nanoscale organization

  • Advanced imaging methods:

    • Super-resolution microscopy (PALM/STORM) to visualize complex distribution

    • Correlative light and electron microscopy to link function with structure

    • Cryo-electron tomography of thylakoid membranes to observe native organization

  • Computational approaches:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations

    • Brownian dynamics to model electron tunneling pathways

    • Machine learning analysis of spectroscopic data

    • Integrative structural modeling combining multiple data sources

When implementing these techniques, researchers should calibrate instruments using known standard systems and include appropriate controls. Data interpretation should consider the limitations of each method, particularly temporal and spatial resolution constraints.

How can proteomics approaches be used to study the interactome of petC in potato chloroplasts?

Proteomics offers powerful tools for unraveling the petC interactome in potato chloroplasts:

Comprehensive Proteomics Strategy:

  • Sample preparation methods:

    • Chloroplast isolation using Percoll gradient centrifugation

    • Membrane protein extraction with mild detergents (digitonin, DDM)

    • Crosslinking with MS-compatible reagents (DSS, DSSO)

    • Subfractionation to enrich thylakoid membranes

  • Interaction capture techniques:

    • Co-immunoprecipitation with anti-petC antibodies

    • Tandem affinity purification using tagged petC variants

    • Proximity labeling using BioID or APEX2 fusions

    • Chemical crosslinking followed by MS (XL-MS)

    • Hydrogen-deuterium exchange MS to map interaction surfaces

  • Mass spectrometry approaches:

    • Data-dependent acquisition for comprehensive profiling

    • Parallel reaction monitoring for targeted quantification

    • Data-independent acquisition for improved reproducibility

    • Native MS to preserve intact protein complexes

  • Data analysis workflows:

    • Specialized search algorithms for crosslinked peptides

    • Label-free quantification of interaction dynamics

    • Stoichiometry determination from intensity-based methods

    • Network analysis to identify functional modules

    • Integration with available protein structure data

  • Validation methods:

    • Reciprocal pulldowns of identified interactors

    • Bimolecular fluorescence complementation

    • Yeast two-hybrid screening

    • In vitro binding assays with purified components

Research using similar approaches in Lemna perpusilla has demonstrated that petC interacts with not only core cytochrome b6-f components but also with assembly factors and chloroplast chaperones. These interactions are critical for complex stability, as demonstrated by the rapid degradation of other subunits when petC is absent .

What are the most promising research directions for studying recombinant petC from Solanum tuberosum?

Future research on potato petC should prioritize these promising directions:

  • Structural biology advances:

    • High-resolution cryo-EM structures of potato-specific cytochrome b6-f

    • Time-resolved structural studies during electron transfer

    • Nanoscale organization within native thylakoid membranes

  • Synthetic biology applications:

    • Designer electron transport chains with modified efficiency

    • Engineering electron transfer properties through targeted mutations

    • Incorporation of non-native cofactors for expanded functionality

  • Climate adaptation studies:

    • petC variants adapted to different temperature optima

    • Modification of regulatory elements for stress-responsive expression

    • Engineering for improved photoprotection during stress conditions

  • Systems biology integration:

    • Multi-omics approaches connecting petC function to global metabolism

    • Machine learning to predict phenotypic outcomes of petC modifications

    • Development of predictive models for electron transport optimization

  • Translational research:

    • Engineering petC to enhance photosynthetic efficiency

    • Development of high-throughput screening platforms for optimized variants

    • Integration with crop improvement programs for yield enhancement

These research directions should employ interdisciplinary approaches combining structural biology, biophysics, genetics, and computational modeling to advance our understanding of this critical photosynthetic component.

How might our understanding of petC contribute to improving photosynthetic efficiency in crop plants?

Understanding petC function provides multiple pathways to improve photosynthetic efficiency:

  • Optimizing electron transport rates:

    • Engineer petC variants with altered midpoint potentials

    • Modify rate-limiting steps in electron transfer

    • Balance electron flow between linear and cyclic pathways

    • Create temperature-tolerant variants for climate resilience

  • Improving photoprotection:

    • Modify regulatory mechanisms to accelerate NPQ induction/relaxation

    • Engineer faster transitions between linear and cyclic electron flow

    • Improve excess energy dissipation during fluctuating light conditions

  • Enhancing complex stability:

    • Identify and modify degradation signals

    • Engineer enhanced assembly efficiency

    • Improve protein stability under stress conditions

  • Manipulating proton gradient formation:

    • Optimize proton pumping efficiency

    • Engineer variants with altered Q-cycle mechanistics

    • Balance ATP/NADPH production ratios

Studies with the cytochrome b6-f complex suggest that even small improvements in electron transport efficiency could translate to significant yield increases (5-15%) under field conditions. The cytochrome b6-f complex is often considered a bottleneck in photosynthetic electron transport, making it a high-value target for crop improvement .

Implementation strategy:

  • Test modifications in model plants

  • Validate in potato using diploid breeding lines

  • Transfer beneficial variants to tetraploid commercial varieties

  • Field test under multiple environmental conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.