Recombinant Solanum tuberosum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction

Solanum tuberosum Cytochrome b6-f complex subunit 4 (petD) is a vital component of the cytochrome b6-f complex found in potato plants[*] . This complex mediates electron transfer between Photosystem II and Photosystem I, playing a crucial role in photosynthesis . The petD subunit is essential for the assembly and function of this complex .

Protein Information

PetD, also known as Cytochrome b6-f complex subunit 4, is a 17 kDa polypeptide . The full-length protein in Solanum bulbocastanum consists of 160 amino acids . The amino acid sequence for Solanum tuberosum petD is: MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPPDPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF .

Table 1: petD Protein Information

FeatureDescription
Recommended NameCytochrome b6-f complex subunit 4
Alternative Name(s)17 kDa polypeptide
Gene NamepetD
Expression Region1-160
UniProt No.Q2VEE9

Function of Cytochrome b6-f Complex

The cytochrome b6-f complex is critical for several photosynthetic processes:

  1. Electron Transfer: It mediates the transfer of electrons between Photosystem II (PSII) and Photosystem I (PSI) .

  2. Cyclic Electron Flow: It participates in cyclic electron flow around PSI .

  3. State Transitions: It is involved in state transitions, which optimize light harvesting and energy distribution in response to changing environmental conditions .

Recombinant Production

Recombinant petD can be produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . A recombinant glycolate dehydrogenase polyprotein expression in potato (Solanum tuberosum) plastids enhances photosynthesis and tuber yield . Recombinant Solanum lycopersicum Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged is also available .

Applications

Recombinant petD is useful for:

  • ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) .

  • Western blotting: Antibodies against petD are used in Western blotting to detect the protein in plant and algal protein extracts .

  • Research: Studying its role in photosynthesis and plant physiology .

Antibodies

Table 2: Antibodies for petD Detection

Catalog NumberClonalityHostReactivity
AS22 4711PolyclonalRabbitArabidopsis thaliana, Synechocystis sp., Synechococcus sp., Cyanobacterium aponinum, Chlorogloeopsis sp.
AS20 4377PolyclonalRabbitArabidopsis thaliana, Cucumis sativus, Echinola crus-galli, Ficus elastica, Lupinus angustifolius, Nicotiana tabacum, Phaseolus coccineus , Picea abies, Pinus sylvestris, Pisum sativum, Solanum tuberosum, Synechococcus elongatus PCC7942 , Zea mays

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPPDPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: sot:4099875

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6f complex and what role does it play in potato photosynthesis?

The cytochrome b6f complex (Cyt b6f) is a multisubunit protein complex embedded in the thylakoid membrane that plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis. In potatoes, as in other plants and cyanobacteria, this complex consists of four large subunits responsible for organizing the electron transfer chain, plus four small subunits that are unique to oxygenic photosynthesis . The complex functions as an electron carrier between photosystem II and photosystem I while simultaneously pumping protons across the thylakoid membrane to generate a proton gradient necessary for ATP synthesis.

What experimental conditions are recommended for optimal expression of recombinant petD protein?

For optimal expression of recombinant petD protein from Solanum tuberosum, researchers should consider the following methodological approach:

Table 1: Recommended Conditions for Recombinant petD Expression

ParameterRecommended ConditionNotes
Expression systemE. coli BL21(DE3) or similarChloroplast proteins often require specialized strains
Temperature16-20°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGLower IPTG concentrations favor soluble protein
Expression time16-20 hoursExtended time at lower temperatures improves folding
Media supplements5-10% glycerolEnhances membrane protein stability
CofactorsAdd heme precursorsSupports proper incorporation of prosthetic groups

The expression protocol should include careful optimization of these parameters, as membrane proteins like cytochrome b6f subunits often present challenges for recombinant expression.

What are effective methods for isolating intact cytochrome b6f complex from potato chloroplasts?

Isolation of intact cytochrome b6f complex from potato chloroplasts requires a careful methodological approach:

  • Chloroplast Isolation: Begin with fresh potato leaves (preferably from plants grown under controlled conditions as outlined in the potato field experiment protocol) . Homogenize leaf tissue in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA, 1 mM MgCl₂, 1% BSA) followed by filtration and differential centrifugation.

  • Thylakoid Membrane Preparation: Osmotically rupture chloroplasts in hypotonic buffer (10 mM HEPES-KOH pH 7.5, 5 mM MgCl₂) and collect thylakoid membranes by centrifugation.

  • Solubilization: Solubilize membranes using a gentle detergent such as n-dodecyl-β-D-maltoside (0.5-1.0%) in buffer containing 20 mM HEPES-KOH pH 7.5, 10% glycerol, and 10 mM NaCl.

  • Purification: Apply the solubilized sample to a series of chromatographic steps:

    • Ion exchange chromatography (DEAE-Sepharose)

    • Hydroxyapatite chromatography

    • Size exclusion chromatography

  • Verification: Confirm complex integrity through spectroscopic analysis (absorption peaks at 554, 563, and 635 nm) and SDS-PAGE to verify the presence of all subunits including petD.

The success of this isolation is highly dependent on maintaining the structural integrity of the complex through careful buffer optimization and gentle solubilization conditions.

How can gene-specific mutations in petD be generated and characterized in potato?

Creating and characterizing gene-specific mutations in the petD gene requires a multifaceted approach:

  • CRISPR/Cas9 Genome Editing:

    • Design guide RNAs targeting specific regions of the petD gene

    • Deliver CRISPR/Cas9 components via Agrobacterium-mediated transformation

    • Select transformed plantlets on appropriate selective media

    • Screen for mutations using PCR and sequencing

  • Chloroplast Transformation:

    • Create a vector containing the mutated petD sequence flanked by homologous regions

    • Transform isolated potato chloroplasts using biolistic methods

    • Select transformants on spectinomycin-containing medium

    • Confirm homoplasmy through multiple rounds of selection

  • Phenotypic Characterization:

    • Measure oxygen evolution activity (as done with petN mutants)

    • Assess electron transport rates using artificial electron acceptors like TMPD

    • Analyze the sensitivity to specific inhibitors such as 2,5-dibromo-3-methyl-6-isopropylbenzoquinone

    • Determine the PSII/PSI ratio using spectroscopic methods

    • Evaluate state transitions using 77K fluorescence spectra

  • Biochemical Analysis:

    • Quantify cytochrome b6f complex abundance

    • Assess complex stability through native gel electrophoresis

    • Characterize the redox properties of the complex

By comparing these results with those from the petN deletion study, researchers can gain insights into the specific functions of the petD subunit within the complex.

What analytical techniques are most effective for characterizing the insertion of recombinant petD into functional complexes?

The following analytical techniques are recommended for characterizing petD incorporation:

Table 2: Analytical Techniques for petD Characterization

TechniqueApplicationParameters
Blue Native PAGEComplex integrity4-16% gradient gels, 0.02% Coomassie G-250
Western blottingSubunit detectionAnti-petD antibodies, 1:1000-1:5000 dilution
Absorbance spectroscopyHeme incorporationPeaks at 554, 563, and 635 nm
Circular dichroismSecondary structureFar-UV (190-250 nm) for α-helical content
Electron microscopyComplex architectureNegative staining or cryo-EM
Mass spectrometryProtein identificationMALDI-TOF or LC-MS/MS
Fluorescence spectroscopyState transitions77K fluorescence emission spectra
Activity assaysElectron transportPlastoquinol-cytochrome c reductase activity

When applying these techniques, researchers should prepare multiple controls, including samples from wild-type plants and those with known mutations in other cytochrome b6f subunits (such as petN) .

How does the loss of petD compare to the loss of petN in terms of impact on cytochrome b6f complex stability and function?

Based on research with petN mutants, we can draw comparisons to predict and understand the effects of petD deletion:

When petN (a small subunit) is deleted, the cytochrome b6f complex is destabilized, with large subunit levels decreasing to 20-25% of wild-type levels . Oxygen evolution activity drops to approximately 30% of normal capacity, indicating significant impairment of electron transport . The plastoquinone pool becomes largely reduced under normal light conditions, and there is a shift in the PSII/PSI ratio .

By comparison, petD deletion would likely have even more severe consequences:

  • Complex Assembly: As one of the four large subunits responsible for organizing the electron transfer chain, petD deletion would likely cause complete failure of complex assembly rather than just destabilization.

  • Electron Transport: Based on the function of large subunits, both linear and cyclic electron transport would be more severely compromised than observed in petN mutants.

  • Photosynthetic Parameters: Expected effects include:

    • Complete inhibition of oxygen evolution that cannot be restored with electron carriers like TMPD

    • Severe reduction of the plastoquinone pool

    • More dramatic alterations in PSII/PSI ratio

    • Complete abolishment of state transitions

  • Growth Phenotype: Unlike petN mutants, which can maintain some growth, petD mutants would likely display severe growth retardation or lethality due to the essential nature of the large subunits.

The differential impact highlights the hierarchical importance of subunits within the complex, with large subunits like petD playing more fundamental structural roles than small subunits like petN.

What approaches can resolve contradictions in experimental data regarding petD function across different research studies?

Resolving contradictions in experimental data regarding petD function requires a systematic approach:

  • Standardized Experimental Protocols:

    • Implement detailed protocols similar to those used for potato field experiments

    • Document all growth conditions, including light intensity, photoperiod, temperature, and nutrient status

    • Standardize plant developmental stage for sampling

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate functional measurements with molecular changes

    • Implement network analysis to identify coordinated responses

  • Comparative Analysis Across Species:

    • Compare results from Solanum tuberosum with other model organisms

    • Analyze evolutionary conservation of structure-function relationships

    • Consider differences in chloroplast genome organization

  • Technical Replication and Validation:

    • Employ multiple complementary techniques (e.g., spectroscopy and fluorescence)

    • Use both in vitro and in vivo approaches

    • Validate key findings across independent laboratories

  • Confounding Factors Analysis:

    • Identify potential compensatory mechanisms

    • Account for pleiotropic effects of mutations

    • Consider indirect effects on related photosynthetic components

Table 3: Strategy for Resolving Experimental Contradictions

Contradiction TypeResolution ApproachExpected Outcome
Activity level discrepanciesStandardize electron acceptors and donorsNormalized activity measurements
Complex stability differencesUnified solubilization and purification protocolsComparable stability assessments
Phenotypic variationControl of environmental conditions using standard protocols Reduced phenotypic noise
Gene expression inconsistenciesSynchronized sampling and RNA preservationReliable expression profiles
Structural role uncertaintiesCryo-EM of complexes from multiple sourcesConsensus structural model

What computational modeling approaches can predict the impact of specific amino acid substitutions in petD on cytochrome b6f complex stability?

Advanced computational modeling approaches can provide valuable insights into the effects of petD mutations:

  • Homology Modeling and Molecular Dynamics:

    • Generate a homology model of potato petD based on crystallographic structures from related species

    • Perform molecular dynamics simulations (100-500 ns) to assess stability

    • Calculate free energy of folding (ΔG) for wild-type and mutant structures

    • Analyze hydrogen bonding networks and salt bridges at subunit interfaces

  • Machine Learning Predictions:

    • Train models on existing mutation data from cytochrome complexes

    • Implement feature extraction based on physicochemical properties

    • Use supervised learning to predict stability changes (ΔΔG)

    • Validate predictions against experimental thermal stability measurements

  • Quantum Mechanical Calculations:

    • Perform QM/MM simulations of the active site

    • Calculate electron transfer rates for wild-type and mutant structures

    • Model redox potential changes resulting from mutations

  • Network Analysis:

    • Construct residue interaction networks

    • Identify critical nodes for complex stability

    • Calculate changes in network properties upon mutation

    • Predict allosteric effects of distal mutations

Table 4: Performance Comparison of Computational Methods for petD Mutation Analysis

MethodComputational CostAccuracyBest Application
Homology modelingLowModerateInitial structural assessment
Molecular dynamicsHighHighConformational stability
Machine learningModerateVaries by datasetHigh-throughput screening
QM/MMVery highVery highElectron transfer properties
Network analysisLowModerateAllosteric effect prediction

How can optimal experimental designs for studying petD function be implemented in field conditions?

Implementing field experiments to study petD function requires careful planning:

  • Experimental Design Considerations:

    • Use a randomized complete block design with at least 3 replications

    • Ensure homogeneous experimental fields to minimize environmental variation

    • Include 6 small randomized sub-plots per block with 20 plants per sub-plot

    • Plan for approximately 360 tuber-seeds per genotype and 250 m² of land

  • Data Collection Parameters:

    • Record precise geographical coordinates using the spherical coordinate system in sexagesimal degrees

    • Document all agronomic data including planting date, method, and tuber-seed type

    • Measure photosynthetic parameters under field conditions at multiple growth stages

  • Photosynthetic Measurements:

    • Implement portable chlorophyll fluorescence measurements

    • Conduct gas exchange measurements at standardized times of day

    • Sample leaves for laboratory analysis of cytochrome b6f content

  • Environmental Monitoring:

    • Record temperature, light intensity, and relative humidity continuously

    • Monitor soil moisture and nutrient status throughout the experiment

    • Document any stress events that might affect photosynthetic performance

  • Genotype Selection:

    • Include wild-type controls, petD mutants, and complemented lines

    • Consider varieties with different photoperiod responses and growing cycles

    • Document genetic background information including parental material

By implementing this comprehensive experimental design, researchers can effectively study petD function while accounting for the complexities of field conditions and genetic variation within Solanum tuberosum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.