Solanum tuberosum Cytochrome b6-f complex subunit 4 (petD) is a vital component of the cytochrome b6-f complex found in potato plants[*] . This complex mediates electron transfer between Photosystem II and Photosystem I, playing a crucial role in photosynthesis . The petD subunit is essential for the assembly and function of this complex .
PetD, also known as Cytochrome b6-f complex subunit 4, is a 17 kDa polypeptide . The full-length protein in Solanum bulbocastanum consists of 160 amino acids . The amino acid sequence for Solanum tuberosum petD is: MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPPDPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF .
| Feature | Description |
|---|---|
| Recommended Name | Cytochrome b6-f complex subunit 4 |
| Alternative Name(s) | 17 kDa polypeptide |
| Gene Name | petD |
| Expression Region | 1-160 |
| UniProt No. | Q2VEE9 |
The cytochrome b6-f complex is critical for several photosynthetic processes:
Electron Transfer: It mediates the transfer of electrons between Photosystem II (PSII) and Photosystem I (PSI) .
Cyclic Electron Flow: It participates in cyclic electron flow around PSI .
State Transitions: It is involved in state transitions, which optimize light harvesting and energy distribution in response to changing environmental conditions .
Recombinant petD can be produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . A recombinant glycolate dehydrogenase polyprotein expression in potato (Solanum tuberosum) plastids enhances photosynthesis and tuber yield . Recombinant Solanum lycopersicum Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged is also available .
Recombinant petD is useful for:
ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) .
Western blotting: Antibodies against petD are used in Western blotting to detect the protein in plant and algal protein extracts .
Research: Studying its role in photosynthesis and plant physiology .
| Catalog Number | Clonality | Host | Reactivity |
|---|---|---|---|
| AS22 4711 | Polyclonal | Rabbit | Arabidopsis thaliana, Synechocystis sp., Synechococcus sp., Cyanobacterium aponinum, Chlorogloeopsis sp. |
| AS20 4377 | Polyclonal | Rabbit | Arabidopsis thaliana, Cucumis sativus, Echinola crus-galli, Ficus elastica, Lupinus angustifolius, Nicotiana tabacum, Phaseolus coccineus , Picea abies, Pinus sylvestris, Pisum sativum, Solanum tuberosum, Synechococcus elongatus PCC7942 , Zea mays |
KEGG: sot:4099875
The cytochrome b6f complex (Cyt b6f) is a multisubunit protein complex embedded in the thylakoid membrane that plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis. In potatoes, as in other plants and cyanobacteria, this complex consists of four large subunits responsible for organizing the electron transfer chain, plus four small subunits that are unique to oxygenic photosynthesis . The complex functions as an electron carrier between photosystem II and photosystem I while simultaneously pumping protons across the thylakoid membrane to generate a proton gradient necessary for ATP synthesis.
For optimal expression of recombinant petD protein from Solanum tuberosum, researchers should consider the following methodological approach:
| Parameter | Recommended Condition | Notes |
|---|---|---|
| Expression system | E. coli BL21(DE3) or similar | Chloroplast proteins often require specialized strains |
| Temperature | 16-20°C | Lower temperatures reduce inclusion body formation |
| Induction | 0.1-0.5 mM IPTG | Lower IPTG concentrations favor soluble protein |
| Expression time | 16-20 hours | Extended time at lower temperatures improves folding |
| Media supplements | 5-10% glycerol | Enhances membrane protein stability |
| Cofactors | Add heme precursors | Supports proper incorporation of prosthetic groups |
The expression protocol should include careful optimization of these parameters, as membrane proteins like cytochrome b6f subunits often present challenges for recombinant expression.
Isolation of intact cytochrome b6f complex from potato chloroplasts requires a careful methodological approach:
Chloroplast Isolation: Begin with fresh potato leaves (preferably from plants grown under controlled conditions as outlined in the potato field experiment protocol) . Homogenize leaf tissue in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA, 1 mM MgCl₂, 1% BSA) followed by filtration and differential centrifugation.
Thylakoid Membrane Preparation: Osmotically rupture chloroplasts in hypotonic buffer (10 mM HEPES-KOH pH 7.5, 5 mM MgCl₂) and collect thylakoid membranes by centrifugation.
Solubilization: Solubilize membranes using a gentle detergent such as n-dodecyl-β-D-maltoside (0.5-1.0%) in buffer containing 20 mM HEPES-KOH pH 7.5, 10% glycerol, and 10 mM NaCl.
Purification: Apply the solubilized sample to a series of chromatographic steps:
Ion exchange chromatography (DEAE-Sepharose)
Hydroxyapatite chromatography
Size exclusion chromatography
Verification: Confirm complex integrity through spectroscopic analysis (absorption peaks at 554, 563, and 635 nm) and SDS-PAGE to verify the presence of all subunits including petD.
The success of this isolation is highly dependent on maintaining the structural integrity of the complex through careful buffer optimization and gentle solubilization conditions.
Creating and characterizing gene-specific mutations in the petD gene requires a multifaceted approach:
CRISPR/Cas9 Genome Editing:
Design guide RNAs targeting specific regions of the petD gene
Deliver CRISPR/Cas9 components via Agrobacterium-mediated transformation
Select transformed plantlets on appropriate selective media
Screen for mutations using PCR and sequencing
Chloroplast Transformation:
Create a vector containing the mutated petD sequence flanked by homologous regions
Transform isolated potato chloroplasts using biolistic methods
Select transformants on spectinomycin-containing medium
Confirm homoplasmy through multiple rounds of selection
Phenotypic Characterization:
Measure oxygen evolution activity (as done with petN mutants)
Assess electron transport rates using artificial electron acceptors like TMPD
Analyze the sensitivity to specific inhibitors such as 2,5-dibromo-3-methyl-6-isopropylbenzoquinone
Determine the PSII/PSI ratio using spectroscopic methods
Evaluate state transitions using 77K fluorescence spectra
Biochemical Analysis:
Quantify cytochrome b6f complex abundance
Assess complex stability through native gel electrophoresis
Characterize the redox properties of the complex
By comparing these results with those from the petN deletion study, researchers can gain insights into the specific functions of the petD subunit within the complex.
The following analytical techniques are recommended for characterizing petD incorporation:
When applying these techniques, researchers should prepare multiple controls, including samples from wild-type plants and those with known mutations in other cytochrome b6f subunits (such as petN) .
Based on research with petN mutants, we can draw comparisons to predict and understand the effects of petD deletion:
When petN (a small subunit) is deleted, the cytochrome b6f complex is destabilized, with large subunit levels decreasing to 20-25% of wild-type levels . Oxygen evolution activity drops to approximately 30% of normal capacity, indicating significant impairment of electron transport . The plastoquinone pool becomes largely reduced under normal light conditions, and there is a shift in the PSII/PSI ratio .
By comparison, petD deletion would likely have even more severe consequences:
Complex Assembly: As one of the four large subunits responsible for organizing the electron transfer chain, petD deletion would likely cause complete failure of complex assembly rather than just destabilization.
Electron Transport: Based on the function of large subunits, both linear and cyclic electron transport would be more severely compromised than observed in petN mutants.
Photosynthetic Parameters: Expected effects include:
Complete inhibition of oxygen evolution that cannot be restored with electron carriers like TMPD
Severe reduction of the plastoquinone pool
More dramatic alterations in PSII/PSI ratio
Complete abolishment of state transitions
Growth Phenotype: Unlike petN mutants, which can maintain some growth, petD mutants would likely display severe growth retardation or lethality due to the essential nature of the large subunits.
The differential impact highlights the hierarchical importance of subunits within the complex, with large subunits like petD playing more fundamental structural roles than small subunits like petN.
Resolving contradictions in experimental data regarding petD function requires a systematic approach:
Standardized Experimental Protocols:
Multi-omics Integration:
Combine transcriptomics, proteomics, and metabolomics data
Correlate functional measurements with molecular changes
Implement network analysis to identify coordinated responses
Comparative Analysis Across Species:
Compare results from Solanum tuberosum with other model organisms
Analyze evolutionary conservation of structure-function relationships
Consider differences in chloroplast genome organization
Technical Replication and Validation:
Employ multiple complementary techniques (e.g., spectroscopy and fluorescence)
Use both in vitro and in vivo approaches
Validate key findings across independent laboratories
Confounding Factors Analysis:
Identify potential compensatory mechanisms
Account for pleiotropic effects of mutations
Consider indirect effects on related photosynthetic components
Advanced computational modeling approaches can provide valuable insights into the effects of petD mutations:
Homology Modeling and Molecular Dynamics:
Generate a homology model of potato petD based on crystallographic structures from related species
Perform molecular dynamics simulations (100-500 ns) to assess stability
Calculate free energy of folding (ΔG) for wild-type and mutant structures
Analyze hydrogen bonding networks and salt bridges at subunit interfaces
Machine Learning Predictions:
Train models on existing mutation data from cytochrome complexes
Implement feature extraction based on physicochemical properties
Use supervised learning to predict stability changes (ΔΔG)
Validate predictions against experimental thermal stability measurements
Quantum Mechanical Calculations:
Perform QM/MM simulations of the active site
Calculate electron transfer rates for wild-type and mutant structures
Model redox potential changes resulting from mutations
Network Analysis:
Construct residue interaction networks
Identify critical nodes for complex stability
Calculate changes in network properties upon mutation
Predict allosteric effects of distal mutations
| Method | Computational Cost | Accuracy | Best Application |
|---|---|---|---|
| Homology modeling | Low | Moderate | Initial structural assessment |
| Molecular dynamics | High | High | Conformational stability |
| Machine learning | Moderate | Varies by dataset | High-throughput screening |
| QM/MM | Very high | Very high | Electron transfer properties |
| Network analysis | Low | Moderate | Allosteric effect prediction |
Implementing field experiments to study petD function requires careful planning:
Experimental Design Considerations:
Data Collection Parameters:
Photosynthetic Measurements:
Implement portable chlorophyll fluorescence measurements
Conduct gas exchange measurements at standardized times of day
Sample leaves for laboratory analysis of cytochrome b6f content
Environmental Monitoring:
Record temperature, light intensity, and relative humidity continuously
Monitor soil moisture and nutrient status throughout the experiment
Document any stress events that might affect photosynthetic performance
Genotype Selection:
By implementing this comprehensive experimental design, researchers can effectively study petD function while accounting for the complexities of field conditions and genetic variation within Solanum tuberosum.