Recombinant Solanum tuberosum Hexokinase-1 (HXK1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Solanum tuberosum Hexokinase-1 (HXK1)

Recombinant Solanum tuberosum Hexokinase-1 (HXK1) is a yeast-derived enzyme engineered to replicate the functional properties of native potato hexokinase. Hexokinases catalyze the phosphorylation of glucose and fructose, a critical step in glycolysis and sugar signaling pathways. In plants, HXK1 also serves as a glucose sensor, integrating metabolic and stress-response signals . The recombinant variant retains these biochemical properties while enabling standardized experimental use .

Enzymatic Activity

  • Glucose phosphorylation: Recombinant HXK1 restores glucose sensitivity in Arabidopsis gin2-1 mutants .

  • Fructose phosphorylation: Minimal activity observed, consistent with plant-specific substrate preferences .

  • Kinase-dependent signaling: Phosphorylates transcription factors (e.g., MdbHLH3 in apple) to regulate stress responses and secondary metabolism .

Metabolic Studies

  • Used to investigate glucose-mediated signaling cascades in plant cells .

  • Functional complementation assays in HXK-deficient yeast strains (e.g., YSH7.4-3C) .

Stress Response Analysis

  • Overexpression studies link HXK1 to drought tolerance and reactive oxygen species (ROS) modulation .

  • Silencing experiments (Hxk1 VIGS lines) demonstrate its role in programmed cell death (PCD) via cytochrome c release and caspase-like activation .

Protein Interaction Networks

  • Associates with VHA-B1 and RPT5B in nuclear glucose-sensing complexes .

  • Phosphorylation of transcription factors (e.g., MdbHLH3) stabilizes anthocyanin biosynthesis complexes under stress .

Stability and Handling

  • Lyophilized stability: 12 months at -20°C/-80°C .

  • Reconstitution guidance: Avoid repeated freeze-thaw cycles; aliquot for long-term storage .

  • Activity preservation: Glycerol supplementation (50% final concentration) recommended for extended usability .

Comparative Insights Across Species

SpeciesHXK1 FunctionKey Reference
Solanum tuberosumGlucose phosphorylation, mitochondrial association, stress signaling
Arabidopsis thalianaNuclear glucose sensing, ethylene/ABA signaling crosstalk
Malus domesticaAnthocyanin biosynthesis via TF phosphorylation
Fragaria vescaDrought response and glucose metabolism regulation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
HXK1; HXK; Hexokinase-1; StHK1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-498
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
HXK1
Target Protein Sequence
MKKVTVGAAVVGAAAVCAVAALIVNHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGQSSRCLSPMSIISQLVMKLGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALFDYIAAELAKFVAAEEEKFHQPPGKQRELGFHLLIPSNADFNNSGTIMRWTKGFSIDDAVGQDVVGELTKAMKEKVLDMRVSALVNDTVGTLAGGKYTQKDVAVAVILGTGTNAAYVERVQAIPKWHGPVPKSGEMVINMEWGNFRSSHLPLTEYDHALDNESLNPAEQIFEKMTSGMYLGEILRRVLTRVAEEVLAFLAMRSLQSLKDSFVLRTPDMSAMHHDTSPDLKVVGEKLKDILEISNTSLKTRKLVLSLCNIVATRGARLDAAGVLGILKKMGRDTPKQGGSERTVIAMDGGLYEHYTEYRMCLENSLKDLLGEELATSIVFVHSNDGSGIGAALLRASHSMYLEDQA
Uniprot No.

Target Background

Function
Hexokinase-1 (HXK1) is a fructose and glucose phosphorylating enzyme found in Solanum tuberosum (potato). It may play a role in glucose phosphorylation during its export from plastids to the cytosol. Current evidence suggests that HXK1 is not involved in cell sugar sensing or carbohydrate metabolism in tubers.
Database Links

KEGG: sot:102604144

UniGene: Stu.19430

Protein Families
Hexokinase family
Subcellular Location
Plastid, chloroplast outer membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in young and mature leaves, stems, roots, stolons, and developing and mature tubers.

Q&A

What is the biological function of Solanum tuberosum Hexokinase-1?

Solanum tuberosum Hexokinase-1 (StHXK1) is a bifunctional enzyme that catalyzes the phosphorylation of glucose to glucose-6-phosphate as its primary metabolic function. Beyond this catalytic role, StHXK1 serves as a glucose sensor involved in signaling pathways that regulate plant growth, nitrogen utilization, and stress resistance. The enzyme participates in glucose-mediated gene regulation and influences various physiological processes including shoot branching and stress responses. Similar to Arabidopsis HXK1, potato hexokinase likely forms signaling complexes with other proteins to mediate its regulatory functions .

How does StHXK1 expression vary across different plant tissues?

Expression analysis reveals that StHXK1 exhibits tissue-specific expression patterns. Using real-time quantitative PCR (RT-qPCR), research has demonstrated that StHXK1 expression is highest in roots, followed by moderate expression in crown tissues and lower expression in mature leaves. This differential expression suggests tissue-specific functions and regulatory mechanisms . The high expression in roots aligns with the enzyme's role in carbohydrate metabolism in these sink tissues, which rely heavily on imported sugars for energy and growth.

What is the relationship between StHXK1 and drought stress response?

StHXK1 appears to play an important role in drought stress responses. Under PEG-simulated drought conditions, the expression level of StHXK1 follows a biphasic pattern - initially increasing and then decreasing within the first 24 hours, followed by a significant burst of expression at 48 hours when leaf wilting begins to occur. This expression pattern suggests that HXK1 is involved throughout the stress response and recovery process . The presence of drought-inducible and ABA-responsive elements in the StHXK1 promoter further supports its role in stress adaptation mechanisms.

What key structural domains and residues are critical for StHXK1 function?

StHXK1 contains several conserved domains essential for its function. These include:

  • Mitochondrial targeting signals and nuclear localization signals (NLS)

  • Conserved phosphate regions (P1 and P2)

  • Sugar-binding domain (S) and adenosine-binding domain (A)

Among these, the serine residue at position 177 (S177) is particularly critical for catalytic activity. Site-directed mutagenesis studies show that the S177A mutation dramatically reduces (>90%) the sugar-phosphorylating ability of the enzyme while maintaining some signaling functions . This conservation of the catalytic serine residue appears to be consistent across plant species, indicating its evolutionary importance in hexokinase function.

How can the catalytic and signaling functions of StHXK1 be experimentally uncoupled?

The catalytic and signaling functions of StHXK1 can be experimentally uncoupled through site-directed mutagenesis of specific amino acid residues crucial for catalytic activity but not signaling. The most established approach involves creating the S177A mutation, which dramatically reduces catalytic activity while preserving signaling capabilities .

The experimental protocol typically involves:

  • Site-directed mutagenesis of the serine at position 177 to alanine

  • Expression of wild-type and mutant forms in model systems

  • Confirmation of protein expression via western blot using anti-His-Tag antibodies

  • Enzymatic activity assays to verify reduced catalytic function (>90% reduction)

  • Complementation studies in Arabidopsis gin2-1 mutants to assess signaling function

This approach has demonstrated that while the S177A mutant loses most catalytic activity, it can still participate in certain signaling pathways, confirming the bifunctional nature of hexokinase .

What are the known interacting partners of StHXK1 in signaling complexes?

While the specific interacting partners of StHXK1 have not been fully characterized, research on Arabidopsis HXK1 provides insights into likely interaction patterns. In Arabidopsis, HXK1 forms a glucose signaling complex with Vacuolar proton pump subunit B (VHA-B) and the 19S regulatory particle of proteasome subunit (RPT5B) .

Recent studies have also identified interactions between Arabidopsis HXK1 and the catalytic subunits of the Polycomb Repressive Complex 2, namely CURLY LEAF (CLF) and SWINGER (SWN), which facilitate histone H3 lysine27 trimethylation and glucose-mediated gene repression . Additionally, AtHXK1 enhances the degradation of ETHYLENE-INSENSITIVE3 (EIN3) in the nucleus and inhibits ethylene response in the presence of glucose. Based on evolutionary conservation, StHXK1 likely forms similar regulatory complexes, though specific potato interacting partners require further investigation.

What are the established protocols for measuring StHXK1 enzymatic activity?

Reliable measurement of StHXK1 enzymatic activity involves several key steps:

  • Protein extraction and normalization:

    • Extract proteins under conditions that preserve enzyme activity

    • Normalize against internal controls (e.g., actin) using western blot analysis

    • Subtract background endogenous HXK activity from empty vector controls

  • Activity assay:

    • Use spectrophotometric methods that couple glucose phosphorylation to NADH oxidation

    • Measure maximum catalytic activity under standardized conditions

    • Compare wild-type and mutant forms (e.g., S177A) to assess specific activity

  • Protein verification:

    • Separate 40 μg of protein extracts on 10% SDS-PAGE gels

    • Transfer to polyvinylidene difluoride membranes

    • Probe with anti-His-Tag rabbit monoclonal antibody for recombinant protein

    • Use anti-plant-Actin mouse monoclonal antibody as control

    • Visualize using chemiluminescence detection systems

These methods have successfully demonstrated a wide range of hexokinase activities in transgenic plants, from 22% of wild-type activity in antisense transformants to 485% activity in sense transformants in leaves .

How can recombinant StHXK1 be effectively expressed and purified for functional studies?

For functional studies of recombinant StHXK1, researchers typically employ the following expression and purification strategy:

  • Vector construction:

    • Clone the StHXK1 coding sequence into an expression vector (e.g., pEAQ-HT)

    • Include a His-tag for purification purposes

    • Create necessary mutant versions (e.g., S177A) via site-directed mutagenesis

  • Expression options:

    • Transient expression: Use Agrobacterium-mediated infiltration in Nicotiana benthamiana leaves

    • Stable transformation: Transform Arabidopsis thaliana plants (particularly gin2-1 mutants for complementation studies) using the floral dip method

  • Protein purification:

    • Extract total protein from plant tissue

    • Purify His-tagged recombinant proteins using nickel affinity chromatography

    • Verify purity and identity via SDS-PAGE and western blotting

  • Functional verification:

    • Assay enzymatic activity of purified protein

    • Perform complementation tests in appropriate mutant backgrounds

    • Analyze substrate specificity and kinetic parameters

This approach allows for both biochemical characterization and in planta functional studies of the recombinant enzyme.

What methodological approaches are recommended for studying StHXK1's dual roles in metabolism and signaling?

To effectively study the dual roles of StHXK1, researchers should employ a multi-faceted approach:

  • For metabolic function assessment:

    • Measure enzyme kinetics with various substrates

    • Quantify flux control coefficients (which can reach 1.71 at normal or below HK activity but drop to 0.32 at very high HK levels)

    • Analyze metabolite profiles (sugars, organic acids, amino acids) in plants with altered HXK1 expression

    • Measure glycolytic flux and respiratory rates

  • For signaling function assessment:

    • Complementation studies with catalytically inactive mutants (S177A)

    • Analyze downstream gene expression changes through transcriptomics

    • Monitor photosynthesis-related gene expression (e.g., CAB genes)

    • Assess plant phenotypes related to glucose sensing (e.g., growth inhibition by high glucose)

  • For interaction studies:

    • Perform co-immunoprecipitation to identify interacting partners

    • Use yeast two-hybrid or bimolecular fluorescence complementation for direct interaction verification

    • Conduct ChIP analyses to identify genome targets when appropriate

This integrated approach allows for distinguishing between metabolic and signaling contributions to observed phenotypes.

How does modulation of StHXK1 expression affect plant growth and development?

Transgenic manipulation of StHXK1 expression results in complex effects on plant growth and development:

  • Root growth: Antisense HXK1 plants (reduced activity) typically show better root growth compared to sense HXK1 plants (increased activity) . This growth difference correlates with altered energetic status in the roots.

  • Shoot branching: HXK1 signaling promotes shoot branching. HXK1-deficient plants display decreased shoot branching and are hypersensitive to auxin. Importantly, complementation with catalytically inactive HXK1 can restore shoot branching to wild-type levels, indicating this is a signaling rather than metabolic function .

  • Energy status: Plants with high HXK1 activity show differences in adenylate and free Pi levels compared to plants with lower activity, which may contribute to growth differences .

  • Starch accumulation: In leaves, antisense HXK1 transformants exhibit up to 3-fold increases in starch content after the dark period, along with 2-fold increases in glucose and decreased sucrose content .

These varied effects underscore the complex role of HXK1 in integrating metabolic and signaling functions to regulate growth and development.

What is known about the interaction between StHXK1 and plant hormone signaling pathways?

StHXK1 interacts with multiple hormone signaling pathways, creating a complex regulatory network:

  • Cytokinin interaction: HXK1-deficient plants display decreased cytokinin levels. The branching phenotype of HXK1-deficient plants can be partially restored by cytokinin treatment, suggesting that HXK1 signaling works partially through modulation of cytokinin levels or response .

  • Strigolactone pathway: HXK1-deficient plants show increased expression of MAX2, which is required for strigolactone signaling. Significantly, strigolactone deficiency can override the negative impact of HXK1 deficiency on shoot branching, indicating a hierarchical relationship between these pathways .

  • Auxin sensitivity: HXK1-deficient plants exhibit hypersensitivity to auxin, suggesting that HXK1 modulates auxin responsiveness .

  • Ethylene signaling: AtHXK1 has been shown to enhance the degradation of ETHYLENE-INSENSITIVE3 (EIN3) in the nucleus, inhibiting plant response to ethylene when glucose is present. Given the conservation of HXK1 function, StHXK1 likely has similar effects on ethylene signaling .

These interactions illustrate how HXK1 serves as an integration point between sugar signaling and hormone pathways to coordinate plant growth responses.

What role does StHXK1 play in futile cycling of hexose phosphates and how does this affect energy status?

StHXK1 plays a significant role in the futile cycling of hexose phosphates, which has important implications for cellular energy status:

  • Futile cycle mechanism: HXK1 phosphorylates hexoses to hexose-phosphates, which can then be dephosphorylated back to hexoses by hexose-phosphate phosphatases. This cycle consumes ATP without net metabolic progression.

  • Evidence for futile cycling:

    • Detection of enzymes capable of catalyzing both forward and reverse reactions

    • Metabolic tracer experiments using 14C-glucose showing formation of 14C-fructose and 14C-sucrose

    • Measurements of glycolytic flux and O2 uptake showing that differences in glucose phosphorylation do not significantly affect downstream metabolism

  • Energy implications: The futile cycling of hexose phosphates could partially explain the differences in energetic status observed in plants with varying HXK activity levels. Plants with high HXK activity show altered adenylate and free Pi levels compared to those with lower activity .

  • Growth effects: This energy drain through futile cycling likely contributes to the observed growth differences between plants with high and low HXK activity, with antisense (lower HXK activity) roots growing better than sense (higher HXK activity) roots .

This futile cycling represents an important regulatory mechanism that influences energy homeostasis in plant cells.

How can substrate specificity of recombinant StHXK1 be precisely characterized?

Precise characterization of StHXK1 substrate specificity requires a comprehensive kinetic analysis approach:

  • Substrate panel testing:

    • Assess activity with various hexoses (glucose, fructose, mannose)

    • Determine kinetic parameters (Km, Vmax, kcat) for each substrate

    • Calculate specificity constants (kcat/Km) to quantify preference

  • Structure-function analysis:

    • Create point mutations in the sugar-binding domain

    • Assess how mutations affect substrate preference

    • Use molecular docking simulations to predict binding interactions

  • Comparative analysis:

    • Compare substrate preferences with HXK1 from other species

    • Identify conserved residues that determine specificity

    • Correlate differences in amino acid sequence with substrate preference

  • In vivo validation:

    • Use isotope labeling to track phosphorylation of different substrates in planta

    • Compare predicted preferences with actual metabolic fluxes

    • Assess physiological relevance of in vitro specificity differences

This multi-level approach provides a comprehensive understanding of substrate recognition and catalytic preference of StHXK1.

What experimental approaches can resolve contradictions between metabolic and signaling effects of StHXK1?

Resolving contradictions between metabolic and signaling effects requires sophisticated experimental designs:

  • Separation of functions:

    • Generate a panel of mutants with varying degrees of catalytic activity but intact signaling

    • Create chimeric proteins combining domains from different hexokinases

    • Use inducible expression systems to temporally separate metabolic and signaling effects

  • Targeted metabolomics and fluxomics:

    • Apply 13C metabolic flux analysis to quantify pathway activities

    • Use non-targeted metabolomics to identify unexpected metabolic changes

    • Correlate flux changes with signaling outputs

  • Systems biology approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Develop mathematical models that incorporate both metabolic and signaling functions

    • Use network analysis to identify regulatory hubs and feedback mechanisms

  • Spatial resolution techniques:

    • Apply subcellular fractionation to determine compartment-specific effects

    • Use tissue-specific or cell-type-specific promoters for targeted expression

    • Employ single-cell analysis techniques to resolve cell-to-cell variability

These approaches help decouple the dual functions of HXK1 and resolve apparent contradictions in experimental observations .

What is the molecular basis for the observed flux control coefficient differences at varying StHXK1 activity levels?

The molecular basis for the observed differences in flux control coefficients at varying StHXK1 activity levels involves complex regulatory mechanisms:

This complex control mechanism represents an important area for future research to fully understand how plants regulate carbon flux through primary metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.