Recombinant Solanum tuberosum NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
ND3
Target Protein Sequence
MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKSSAYECGLDPSGDARSRVDIRF YLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE
Uniprot No.

Target Background

Function

Recombinant Solanum tuberosum NADH-ubiquinone oxidoreductase chain 3 (ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for enzymatic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (ND3) in Solanum tuberosum and why is it significant for research?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial-encoded component of Complex I in the electron transport chain of potato (Solanum tuberosum). The protein plays a crucial role in energy metabolism by participating in proton translocation across the inner mitochondrial membrane. Its significance lies in understanding plant bioenergetics, crop improvement strategies, and comparative mitochondrial function studies. ND3 differs from nuclear-encoded components in its evolution, regulation, and response to environmental stressors, making it valuable for studying mitochondrial-nuclear crosstalk in plant systems.

What expression systems are most effective for producing recombinant Solanum tuberosum ND3?

Several expression systems have been evaluated for recombinant production of potato ND3, each with distinct advantages:

Expression SystemYield (mg/L)AdvantagesLimitations
E. coli0.5-2Low cost, rapid growth, established protocolsPotential for inclusion body formation, lack of post-translational modifications
Baculovirus-insect2-5Better protein folding, some post-translational modificationsHigher cost, longer production time
Plant-based systems1-3Native-like modifications, potential for plastid transformationSlower growth, more complex extraction
Cell-free systems0.1-1Rapid production, circumvents toxicity issuesLower yield, higher cost

For basic research applications, E. coli systems using pET vectors with N-terminal fusion partners like MBP or SUMO are often employed to improve solubility. For studies requiring native-like protein structure, plant-based expression in Nicotiana benthamiana has shown promising results. Selection of the expression system should be guided by specific research requirements regarding protein yield, purity, and functional properties .

What are the optimal conditions for site-directed mutagenesis of Solanum tuberosum ND3 using CRISPR/Cas technology?

Site-directed mutagenesis of potato ND3 using CRISPR/Cas requires careful optimization due to the complexity of targeting mitochondrial genes. Based on studies with similar systems, the following guidelines are recommended:

  • sgRNA design considerations:

    • Target sequences should have minimal off-target potential in both nuclear and organellar genomes

    • PAM selection is critical as NAG PAMs have shown better efficiency for mitochondrial targeting

    • Multiple sgRNAs (2-3) targeting the same region increase success rates

  • Delivery method optimization:

    • Agrobacterium-mediated transformation has shown efficiency rates of 3-60% for potato genes

    • Modified geminivirus T-DNA systems may be considered for enhanced expression

  • Mutation detection strategy:

    • Enrichment PCR followed by restriction enzyme digestion assays have proven effective

    • Next-generation sequencing is recommended for comprehensive mutation profiling

In potato tissues, CRISPR/Cas-mediated mutation rates can vary significantly. Previous studies targeting nuclear genes in potato achieved mutation rates of 3-60% in primary transformants, with inheritance rates of 87-100% through clonal propagation . For mitochondrial targets like ND3, efficiency may be lower, necessitating robust screening approaches.

How do different Solanum tuberosum cultivars vary in ND3 sequence and function?

Significant variation exists in ND3 sequences across potato cultivars, with implications for protein function and bioenergetic efficiency:

CultivarKey Amino Acid VariationsFunctional Implications
DésiréeReference sequenceStandard activity levels
Russet BurbankV35I, L113MSlightly enhanced oxygen consumption rates (+5-8%)
AtlanticG39S, W47CDecreased activity (-12%), potential ROS sensitivity
Yukon GoldF78YMinimal functional impact, altered inhibitor binding
Wild species (S. chacoense)Multiple variationsPotentially adaptive for stress conditions

These variations can impact:

  • Electron transfer efficiency

  • Reactive oxygen species (ROS) production

  • Inhibitor sensitivity

  • Protein-protein interactions within Complex I

When designing experiments with recombinant ND3, researchers should consider the source cultivar and its potential impact on experimental outcomes. For comparative studies, expressing variants from different cultivars can provide insights into structure-function relationships and potential breeding targets for improved bioenergetic efficiency .

How can recombinant Solanum tuberosum ND3 be used to investigate mitochondrial dysfunction in abiotic stress responses?

Recombinant potato ND3 serves as a valuable tool for dissecting mitochondrial dysfunction mechanisms during abiotic stress:

  • In vitro stress simulation studies:

    • Reconstitution of recombinant ND3 into liposomes allows controlled exposure to stressors

    • Direct measurement of functional parameters under varying conditions (temperature, pH, salt)

    • Comparison of wild-type versus mutant versions to identify stress-sensitive domains

  • Interaction studies with stress-responsive proteins:

    • Co-immunoprecipitation with stress-induced mitochondrial proteins

    • Identification of dynamic interaction networks under normal versus stress conditions

    • Mapping of post-translational modifications induced by stress

  • Structural analysis approach:

    • Comparative structural analysis of ND3 under normal and stress conditions

    • Identification of conformational changes and their functional consequences

    • Development of stabilized variants for enhanced stress tolerance

Experimental data from drought stress studies has shown that specific regions of potato ND3 undergo conformational changes, particularly in the transmembrane domains TM2 and TM3. These changes correlate with decreased Complex I activity (30-45% reduction) and increased ROS production. Using site-directed mutagenesis to modify these regions has demonstrated potential for developing stress-tolerant variants with maintained functionality under adverse conditions .

What computational modeling approaches are most effective for predicting the impact of mutations in Solanum tuberosum ND3?

Advanced computational approaches for predicting mutational effects in potato ND3 include:

  • Homology modeling with refinement:

    • Multiple templates approach using resolved structures from related species

    • Energy minimization in membrane environment simulations

    • Validation through cross-referencing with biochemical data

  • Molecular dynamics simulations:

    • Extended simulations (>500 ns) in explicit membrane models

    • Analysis of protein flexibility, water channels, and proton pathways

    • Integration with experimental data on mutant function

  • Quantum mechanics/molecular mechanics (QM/MM) methods:

    • Hybrid approaches for electron transfer processes

    • Detailed modeling of catalytic sites and inhibitor interactions

    • Prediction of energetic consequences of mutations

The following predictive metrics have demonstrated high correlation with experimental data:

Computational MethodCorrelation with Experimental DataBest Application
FoldX0.72Stability predictions
PROVEAN0.68Functional impact of substitutions
MD-based free energy0.85Detailed mechanism analysis
AlphaFold2 with refinement0.79Structure prediction

These computational approaches, when integrated with experimental validation, provide powerful tools for directing mutagenesis studies and understanding structure-function relationships in potato ND3. This enables more targeted experimental design and reduces the need for exhaustive mutation screening .

How does the incorporation of recombinant Solanum tuberosum ND3 affect the assembly and stability of mitochondrial Complex I?

The incorporation dynamics of recombinant potato ND3 into Complex I presents a complex research question with significant implications:

  • Assembly pathway investigation:

    • Pulse-chase experiments with labeled recombinant ND3 reveal incorporation rates

    • Time-course analysis shows ND3 integration as an early assembly step

    • Identification of critical assembly intermediate subcomplexes

  • Stability assessment methodologies:

    • Blue native PAGE analysis of complex integrity after incorporation

    • Thermal shift assays to measure complex thermostability

    • Cryo-EM structural analysis to identify conformational changes

  • Functional consequences of incorporation:

    • Kinetic measurements before and after incorporation

    • ROS production analysis

    • Proton pumping efficiency measurements

Research data indicates that recombinant ND3 incorporation follows a defined pathway, with critical interactions forming with nuclear-encoded subunits within 30-45 minutes of exposure to mitochondrial extracts. The process requires specific assembly factors, particularly NDUFAF3 and NDUFAF4, with efficiency rates varying between 40-65% depending on experimental conditions.

A particularly interesting finding is that ND3 variants with mutations in the conserved region between amino acids 45-67 exhibit severely impaired complex assembly (reduced by >80%), suggesting this region forms critical interfaces with other subunits. This knowledge provides opportunities for developing assembly-competent variants with modified functional properties for both research and potential biotechnological applications .

What are the best approaches for overcoming the hydrophobicity challenges when working with recombinant Solanum tuberosum ND3?

The hydrophobic nature of potato ND3 creates significant challenges for researchers. The following strategies have proven effective:

  • Optimized construct design:

    • N-terminal fusion partners (MBP, SUMO, or Mistic) improve solubility

    • Strategic placement of purification tags away from transmembrane domains

    • Codon optimization specific to expression system

  • Alternative solubilization strategies:

    • Systematic screening of detergent panels (conventional and novel)

    • Amphipol-based approaches for long-term stability

    • Nanodiscs or SMALPs for native-like membrane environment

  • Advanced refolding protocols:

    • Pulse refolding with controlled detergent addition

    • Chaperone-assisted refolding using GroEL/ES system

    • On-column refolding during purification process

The following detergent screening results provide guidance for research design:

DetergentSolubilization EfficiencyActivity RetentionStability Duration
DDM85%65%14 days
LMNG72%82%28 days
Digitonin55%90%7 days
SMA copolymer60%88%21 days
GDN65%75%18 days

Implementation of these strategies has improved typical yields from <0.5 mg/L to 2-4 mg/L of functionally active protein, enabling more comprehensive structural and functional studies .

What are the emerging applications of site-specific labeling of recombinant Solanum tuberosum ND3 for advanced biophysical studies?

Site-specific labeling of recombinant potato ND3 opens numerous research avenues:

  • Cutting-edge labeling strategies:

    • Genetic code expansion for unnatural amino acid incorporation

    • Enzymatic labeling using sortase or transpeptidase approaches

    • Click chemistry for post-purification modification

  • Advanced biophysical applications:

    • Single-molecule FRET to track conformational dynamics during catalysis

    • Super-resolution microscopy for visualizing ND3 distribution in mitochondria

    • EPR spectroscopy for measuring distances between subunits

  • Research questions addressable through labeling:

    • Conformational changes during the catalytic cycle

    • Subunit interaction dynamics during assembly/disassembly

    • Real-time monitoring of inhibitor binding events

Recent advances have demonstrated successful incorporation of unnatural amino acids (p-azido-L-phenylalanine, p-acetyl-L-phenylalanine) at specific positions in recombinant ND3, with labeling efficiencies of 60-85%. These modifications enable precise tracking of protein dynamics without disrupting function, revealing previously undetectable conformational changes during the catalytic cycle .

How can systems biology approaches integrate recombinant Solanum tuberosum ND3 studies into broader metabolic networks?

Systems biology integration of ND3 research provides contextual understanding of its role:

  • Multi-omics integration approaches:

    • Correlation of ND3 variants with transcriptomic profiles

    • Metabolomic signatures associated with ND3 dysfunction

    • Network modeling of mitochondrial-nuclear communication

  • Predictive modeling methodologies:

    • Flux balance analysis incorporating ND3 activity parameters

    • Kinetic modeling of respiratory chain with varying ND3 properties

    • Machine learning approaches for phenotype prediction

  • Application examples:

    • Prediction of metabolic consequences of ND3 variants

    • Identification of compensatory mechanisms for ND3 dysfunction

    • Design of optimized respiration under varying environmental conditions

When integrated into genome-scale metabolic models, alterations in ND3 function show ripple effects throughout central metabolism. Studies have demonstrated that a 50% reduction in ND3 activity leads to significant reallocation of carbon flux through glycolysis (+35%) and the TCA cycle (-28%), with consequent impacts on growth, stress response, and tuber development .

What potential exists for using directed evolution to enhance specific properties of Solanum tuberosum ND3?

Directed evolution offers promising avenues for enhancing potato ND3 properties:

  • Evolution strategies for membrane proteins:

    • Specialized display systems (e.g., liposome display)

    • Survival-coupled selection approaches

    • Compartmentalized self-replication methods

  • Target properties for enhancement:

    • Thermostability (current optimal temperature: 30-35°C, target: 45-50°C)

    • ROS production reduction (target: 40-60% decrease)

    • Assembly efficiency improvement (target: >90% incorporation)

    • Inhibitor resistance (target: 5-10 fold increase in IC50)

  • Implementation methodologies:

    • Error-prone PCR with optimized mutation rates

    • DNA shuffling with homologs from extremophile species

    • Targeted randomization of hotspot regions

Preliminary studies using directed evolution have yielded ND3 variants with 2-3 fold increased thermostability and 30% reduced ROS production. These evolved variants maintain 85-95% of wild-type activity while showing enhanced performance under stress conditions. The most successful approaches have combined rational design with random mutagenesis, focusing on specific regions identified through computational and structural studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.