Recombinant Solanum tuberosum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDFFWAFLIISILVPILAFFISGVLAPISKGPEKLSTYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic and possibly chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, plastoquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • What are the optimal conditions for expressing recombinant ndhC protein?

    Recombinant ndhC protein from Solanum tuberosum can be expressed in several host systems, each with specific advantages:

    Host SystemAdvantagesConsiderations
    E. coliRapid growth, high yields, cost-effectiveMay require optimization for membrane protein expression
    YeastPost-translational modifications, eukaryotic systemLonger growth times than bacteria
    BaculovirusHigher-order protein folding, larger proteinsMore complex setup, longer production time
    Mammalian cellsMost complex post-translational modificationsMost expensive, lower yields

    For optimal expression of recombinant ndhC:

    1. Consider using E. coli systems with specialized strains designed for membrane protein expression

    2. Incorporate purification tags (N-terminal His-tag is common) for easier isolation

    3. Express at lower temperatures (16-25°C) to improve proper folding

    4. Use detergents appropriate for membrane protein solubilization during purification

    5. Optimize codon usage for the selected expression system

    The resulting protein typically has >90% purity as determined by SDS-PAGE and is generally stored in a buffer containing glycerol for stability .

  • How should researchers store and handle recombinant ndhC protein to maintain activity?

    For optimal storage and handling of recombinant ndhC protein:

    • Short-term storage (up to one week): Store working aliquots at 4°C

    • Long-term storage: Store at -20°C or -80°C

    • Storage buffer: Use Tris/PBS-based buffer with 6% trehalose at pH 8.0, or a glycerol-containing buffer

    • Avoid repeated freeze-thaw cycles as they can denature the protein and reduce activity

    • For reconstitution of lyophilized protein: Briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for aliquoting and long-term storage

    When working with the protein, maintain cold chain conditions whenever possible and use freshly prepared reagents to ensure optimal protein stability and activity.

  • What experimental approaches can be used to study ndhC function in potato chloroplasts?

    Several experimental approaches can be employed to study ndhC function:

    1. Genetic approaches:

      • CRISPR/Cas9-mediated genome editing of the chloroplast genome

      • Transformation using Agrobacterium tumefaciens for nuclear-encoded complementation studies

      • RNA interference (RNAi) to knock down expression of nuclear factors affecting ndhC

    2. Biochemical approaches:

      • In vitro reconstitution of the NDH complex

      • Electron transport assays measuring NAD(P)H oxidation rates

      • Measurement of proton gradient formation using pH-sensitive probes

    3. Structural approaches:

      • Cryo-electron microscopy of isolated complexes

      • X-ray crystallography of purified protein or subcomplexes

      • Cross-linking studies to identify interaction partners

    4. Physiological approaches:

      • Chlorophyll fluorescence measurements to assess photosystem performance

      • Gas exchange measurements to evaluate photosynthetic efficiency

      • Growth assays under various environmental conditions

    Each approach provides different insights into ndhC function, and combining multiple techniques yields the most comprehensive understanding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.