Recombinant Solanum tuberosum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

ndhE is a subunit of the NAD(P)H dehydrogenase complex, which participates in cyclic electron transport around photosystem I (PSI) and chlororespiration in non-green plastids . While its exact biochemical role remains under investigation, related NAD(P)H-quinone oxidoreductases are known to:

  • Reduce quinones and azo dyes via two-electron transfer.

  • Stabilize electron carriers in chloroplast membranes.

  • Interact with other subunits to form functional oligomers .

Mechanistic Insights
Studies on homologous enzymes (e.g., human NQO1) suggest that subunits may function cooperatively or independently depending on the electron acceptor. For example, heterodimer studies of NAD(P)H:quinone oxidoreductase revealed that subunits act independently with two-electron acceptors but dependently with four-electron acceptors . This mechanism may apply to ndhE in chloroplast electron transport.

Production and Purification

The recombinant ndhE protein is produced via bacterial expression and purified using His-tag affinity chromatography. Key production parameters include:

Reconstitution and Stability

ParameterRecommendation
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol (final conc.)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Short-Term Storage4°C for ≤1 week

Research Applications

Recombinant ndhE is primarily used in:

  1. ELISA-Based Detection: Kits are available for quantifying ndhE in plant extracts (e.g., potato) or recombinant systems .

  2. Structural Studies: The His-tagged protein facilitates crystallization or NMR analysis to elucidate subunit interactions .

  3. Functional Assays: Testing electron transfer activity with quinones or azo dyes, leveraging its role in chloroplast redox pathways .

Comparative Analysis with Related Enzymes

While ndhE is plant-specific, its functional parallels to other NAD(P)H-quinone oxidoreductases highlight broader implications:

EnzymeOrganismSubcellular LocalizationKey Function
ndhESolanum tuberosumChloroplastsCyclic electron transport, chlororespiration
NQO1Homo sapiensCytoplasm, mitochondriaQuinone detoxification, cancer biology
NDH-2Archaea (e.g., Halobacterium)Cell membraneType II NADH:quinone oxidoreduction

Challenges and Future Directions

  • Stability: Lyophilized ndhE requires careful handling to prevent aggregation .

  • Functional Characterization: Limited kinetic data (e.g., Km, kcat) for chloroplast-specific substrates.

  • Evolutionary Studies: Comparing ndhE with homologs in non-photosynthetic organisms could reveal conserved motifs for electron transport.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. The enzyme couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase in Solanum tuberosum and what is the role of the ndhE subunit?

NAD(P)H-quinone oxidoreductases are enzymes that catalyze the two-electron transfer from NAD(P)H to quinones in electron transport chains. In Solanum tuberosum (potato), the chloroplastic NAD(P)H-quinone oxidoreductase complex (NDH complex) plays a crucial role in cyclic electron flow around photosystem I and chlororespiration. The ndhE subunit (subunit 4L) is one of the membrane-embedded components of this complex and is critical for the assembly and stability of the entire NDH complex in chloroplasts . Unlike bacterial type II NDH enzymes that function without energy transduction, the chloroplastic NDH complex in plants contributes to proton gradient formation across the thylakoid membrane, which is essential for ATP synthesis during periods of environmental stress when linear electron flow is limited .

How does chloroplastic ndhE differ from bacterial NDH-2 enzymes?

The chloroplastic ndhE subunit in Solanum tuberosum is part of a multi-subunit complex that more closely resembles bacterial NDH-1 (complex I-like) than NDH-2. While bacterial NDH-2 enzymes function as single polypeptides that catalyze the transfer of electrons from NAD(P)H to quinones without energy transduction, the chloroplastic NDH complex containing ndhE is involved in proton pumping across membranes .

A key difference is that bacterial NDH-2 enzymes, as described in the literature, accomplish the turnover of NAD(P)H without an energy-transducing site, whereas the chloroplastic complex participates in energy conservation. Some organisms possess complex I-like enzymes with 11-12 of the 14 subunits found in the prokaryotic enzyme, with the missing components typically belonging to the flavoprotein fraction, which are the electron input modules . The chloroplastic NDH complex in plants has evolved distinct features for its specialized role in cyclic electron flow around photosystem I.

What is the genetic origin of the ndhE gene in potato chloroplasts?

The ndhE gene in potato chloroplasts is encoded by the chloroplast genome (plastome). It is one of the plastid-encoded NDH subunits that originated from the cyanobacterial ancestor of chloroplasts through endosymbiosis. During evolution, many original cyanobacterial genes were either lost or transferred to the nuclear genome, but ndhE remained in the chloroplast genome of most land plants, including potato. The gene encodes a small hydrophobic protein that is integrated into the thylakoid membrane as part of the NDH complex.

What are the optimal conditions for expressing recombinant potato ndhE in heterologous systems?

When expressing recombinant potato ndhE in heterologous systems, researchers should consider several critical factors:

Expression System Selection:

  • Bacterial systems (E. coli): Use specialized strains optimized for membrane protein expression such as C41(DE3) or C43(DE3)

  • Yeast systems (P. pastoris): Beneficial for eukaryotic post-translational modifications

  • Plant-based expression systems: Consider using Nicotiana benthamiana for transient expression through Agrobacterium-mediated transformation

Expression Conditions Table:

ParameterE. coli SystemYeast SystemPlant System
Temperature16-20°C25-28°C22-24°C
Induction0.1-0.5 mM IPTG0.5% methanolN/A
Duration16-20 hours48-72 hours3-5 days
Media supplements5-10 μM riboflavin1% casamino acidsNone
OD at induction0.6-0.82.0-4.0N/A

Since ndhE is a membrane protein, expression in E. coli often leads to inclusion body formation, which necessitates refolding procedures. To improve solubility, fusion tags such as MBP (maltose-binding protein) or SUMO can be employed. When designing the expression construct, it's essential to consider removing the chloroplast transit peptide, as this can interfere with proper folding in bacterial systems .

What is the appropriate experimental design for studying ndhE function in potato plants?

When designing experiments to study ndhE function in potato plants, a comprehensive approach combining molecular, biochemical, and physiological analyses is recommended. The experimental design should follow these guidelines:

  • Field or Controlled Environment Setup:

    • Use randomized complete block design (RCBD) for field experiments or completely randomized design (CRD) for controlled environment studies

    • Establish a minimum of three biological replicates per treatment

    • Include appropriate wild-type controls and, if possible, known NDH mutants as reference points

  • Plot Design for Field Experiments:

    • Each plot should contain at least 20 plants per sub-plot

    • Include 6 small randomized sub-plots within each block for destructive sampling

    • Total area requirement: approximately 250 m² per genotype with three blocks

  • Data Collection Timeline:

    • Early development: 30-45 days after planting

    • Mid-season: 60-75 days after planting

    • Late season: 90-110 days after planting

    • Post-harvest: tuber analyses

  • Key Parameters to Measure:

    • Photosynthetic parameters (especially under stress conditions)

    • Chlorophyll fluorescence (particularly Fv/Fm and NPQ parameters)

    • Electron transport rates around PSI (using specialized spectroscopic techniques)

    • Protein expression levels (via immunoblotting)

    • Transcript abundance (via RT-qPCR)

  • Environmental Treatments:

    • Normal conditions (control)

    • High light stress

    • Drought stress

    • Temperature stress (cold and heat)

    • Combined stresses to assess NDH complex contribution to stress tolerance

This experimental design enables comprehensive phenotypic and molecular characterization of ndhE function in potato plants under various environmental conditions .

How should researchers approach the purification of recombinant ndhE protein for structural studies?

Purification of recombinant ndhE protein for structural studies presents unique challenges due to its hydrophobic nature and association with membrane complexes. A methodical approach is recommended:

  • Pre-purification Considerations:

    • Express the protein with an affinity tag (His6, FLAG, or Strep-tag II)

    • Include protease inhibitor cocktails in all buffers

    • Maintain samples at 4°C throughout the procedure

    • Use anaerobic conditions when possible to prevent oxidation

  • Membrane Protein Extraction Protocol:

    • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 200 mM NaCl, 5% glycerol

    • Disrupt cells by sonication or high-pressure homogenization

    • Centrifuge at 10,000 × g for 10 minutes to remove cellular debris

    • Ultracentrifuge supernatant at 100,000 × g for 1 hour to isolate membrane fraction

    • Solubilize membrane pellet with appropriate detergent

  • Detergent Selection for Solubilization:

DetergentFinal ConcentrationAdvantagesLimitations
n-Dodecyl β-D-maltoside (DDM)1-2%Mild, maintains protein-protein interactionsRelatively large micelles
n-Decyl β-D-maltoside (DM)1-2%Smaller micelles than DDMLess gentle
Digitonin1%Very mild, preserves supercomplexesExpensive, variable quality
Lauryl maltose neopentyl glycol (LMNG)0.5-1%Low CMC, good for crystallizationLess established
  • Purification Strategy:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA

    • Secondary purification via size exclusion chromatography

    • Optional ion exchange chromatography step for higher purity

    • For structural studies, detergent exchange to more suitable options for crystallization or cryo-EM

  • Quality Assessment:

    • SDS-PAGE and western blotting to confirm identity

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to assess homogeneity

    • Functional assays to confirm activity

For cryo-EM studies, consider reconstitution into nanodiscs or amphipols instead of detergent micelles, as these better mimic the native membrane environment and often improve structural stability.

What biosafety considerations apply when working with recombinant ndhE from potato?

Research involving recombinant ndhE from Solanum tuberosum must comply with institutional biosafety guidelines and relevant regulatory frameworks. The following considerations apply:

  • Regulatory Compliance:

    • Research must adhere to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules (current edition)

    • All recombinant DNA work must be registered with and authorized by the Institutional Biosafety Committee (IBC) before initiation

    • Principal Investigators are responsible for correctly classifying their experiments according to the NIH Guidelines

  • Risk Assessment:

    • Expression of plant chloroplastic proteins in heterologous systems generally falls under NIH Section III-D-1-a for non-pathogenic plants

    • When viral vectors are used for expression, containment levels may increase (refer to specific vector guidelines)

    • The use of Agrobacterium for plant transformation typically requires BSL2 containment

  • Containment Level Determination:

Experimental ApproachNIH ClassificationContainment Level
Cloning ndhE in standard E. coli vectorsIII-EBSL1
Expression using defective viral vectorsIII-D-1-aBSL2
Plant transformation via AgrobacteriumIII-D-5BSL2
Transgenic potato plants expressing modified ndhEIII-D-5-aBL1-P
  • Safety Precautions:

    • Use appropriate personal protective equipment (laboratory coat, gloves, eye protection)

    • Implement proper waste management procedures for recombinant materials

    • Maintain detailed records of experiments and risk assessments

    • Ensure all personnel are properly trained in biosafety procedures

Principal Investigators must select appropriate work practices, protective equipment, and facilities where the work can be conducted safely. When in doubt about classification or appropriate work practices, researchers should contact their institutional Environmental Health and Safety office for guidance .

What are the specific NIH guidelines for working with recombinant potato chloroplast proteins?

When working with recombinant potato chloroplast proteins like ndhE, researchers must follow specific NIH guidelines:

  • Classification Under NIH Guidelines:

    • Experiments involving recombinant DNA from Solanum tuberosum typically fall under Section III-E of the NIH Guidelines, which covers experiments that are exempt from the NIH Guidelines but still require IBC notice

    • If the recombinant protein is expressed using viral vectors, the classification may change to Section III-D-1-a, requiring IBC approval before initiation

  • Definition Relevance:

    • The work meets the NIH definition of recombinant nucleic acids as it involves "molecules that are constructed by joining nucleic acid molecules and that can replicate in a living cell"

    • The definition also extends to "molecules that result from the replication of those described" in the primary definition

  • Registration Requirements:

    • All research involving recombinant ndhE must be registered with the institutional IBC

    • Registration should include detailed information about:

      • The source of the genetic material (Solanum tuberosum)

      • The specific gene (ndhE)

      • Expression systems to be used

      • Experimental procedures

      • Risk assessment

      • Containment measures

  • Containment Considerations:

    • Basic cloning and expression work typically requires Biosafety Level 1 (BSL1)

    • When using plant pathogens like Agrobacterium for transformation, Biosafety Level 2 (BSL2) is required

    • For plant experiments, Biological Plant Containment Level 1 (BL1-P) is generally sufficient for non-noxious plants like potato

  • Documentation Requirements:

    • Maintain detailed laboratory records of all recombinant DNA work

    • Document risk assessments and containment measures

    • Keep records of personnel training on biosafety procedures

    • Report any significant problems, violations, or accidents to the IBC

These guidelines ensure safe and compliant research practices when working with recombinant potato chloroplast proteins while maintaining appropriate oversight through institutional biosafety committees.

How can researchers differentiate between the functions of ndhE and other NDH complex subunits in potato chloroplasts?

Differentiating the specific functions of ndhE from other NDH complex subunits requires sophisticated approaches that isolate the contribution of individual components:

  • CRISPR/Cas9 Gene Editing Approach:

    • Design targeted mutations in the ndhE gene that maintain the reading frame but alter key amino acids

    • Create a series of mutants with varying degrees of function rather than complete knockouts

    • Compare with mutations in other NDH subunits to identify subunit-specific phenotypes

  • Complementation Analysis:

    • In ndhE-deficient plants, introduce modified versions of the gene with specific domain alterations

    • Assess the degree of functional restoration to identify critical regions

    • Cross-complement with homologous genes from other species to determine conserved functions

  • Structure-Function Analysis Protocol:

  • Differential Spectroscopy:

    • Measure P700+ re-reduction kinetics in wild-type versus ndhE-modified plants

    • Use specific inhibitors (e.g., antimycin A) to distinguish between NDH-dependent and PGR5-dependent cyclic electron flow

    • Perform measurements under varying light conditions and CO2 concentrations

  • Proteomics Approach:

    • Perform quantitative proteomic analysis of thylakoid membranes from plants with modified ndhE

    • Identify secondary effects on complex assembly and stability

    • Use protein correlation profiling to assess impacts on interacting proteins and subcomplexes

By employing these complementary approaches, researchers can begin to dissect the specific roles of ndhE distinct from other subunits, elucidating both its structural contributions to complex assembly and potential regulatory functions within the NDH complex .

What are the current methodologies for analyzing electron transport chain modifications in plants expressing recombinant versions of ndhE?

Advanced methodologies for analyzing electron transport chain modifications in plants expressing recombinant versions of ndhE include:

  • Chlorophyll Fluorescence Analysis:

    • Pulse Amplitude Modulation (PAM) fluorometry to measure:

      • PSII quantum yield (ΦII)

      • Non-photochemical quenching (NPQ)

      • Post-illumination chlorophyll fluorescence rise (indicative of NDH activity)

    • Rapid fluorescence induction kinetics (OJIP transitions) to assess electron transport chain efficiency

    • Detailed protocol: Use modulated fluorometer with saturating pulses (>8,000 μmol photons m⁻² s⁻¹) at regular intervals during actinic illumination, followed by dark relaxation periods

  • P700 Absorbance Measurements:

    • Dual-wavelength difference spectroscopy (830-875 nm) to monitor P700 oxidation state

    • Analysis of far-red light-induced P700 oxidation and subsequent re-reduction in darkness

    • Quantification of cyclic electron flow using the initial rate of P700+ re-reduction after switching off far-red light

  • Electrochromic Shift (ECS) Spectroscopy:

    • Measurement of the transthylakoid proton gradient using absorbance changes at 520 nm

    • Dark-interval relaxation kinetics to assess proton conductivity of the thylakoid membrane

    • Comparison of ECS signals in wild-type versus ndhE-modified plants to determine NDH contribution to proton gradient formation

  • Photosynthetic Parameters Comparative Table:

ParameterMeasurement TechniqueExpected Change in ndhE-Modified PlantsPhysiological Significance
Cyclic electron flow rateP700+ re-reduction kineticsDecreased re-reduction rateReduced ATP synthesis capacity
PSII/PSI ratio77K chlorophyll fluorescencePossible compensatory changesAdaptation to altered electron flow
CO2 assimilationGas exchange analysisMay be affected under specific conditionsPhotosynthetic efficiency impact
NPQ inductionPAM fluorometryPotentially altered kineticsChanged photoprotective capacity
Proton motive forceElectrochromic shiftReduced magnitudeDecreased ATP synthase driving force
  • Thylakoid Membrane Complexome Analysis:

    • Blue-native PAGE coupled with in-gel activity assays

    • Second-dimension SDS-PAGE for individual subunit analysis

    • Mass spectrometry for complex composition analysis and post-translational modifications

    • Comparison of NDH-PSI supercomplex formation between wild-type and modified plants

These methodologies, when applied systematically, provide a comprehensive picture of how recombinant versions of ndhE affect electron transport chain function, with particular emphasis on cyclic electron flow and photoprotection under varying environmental conditions .

How can researchers troubleshoot expression problems with recombinant ndhE protein?

Troubleshooting expression problems with recombinant ndhE protein requires systematic investigation of multiple factors:

  • Codon Optimization Assessment:

    • Analyze the codon adaptation index (CAI) for ndhE in your expression system

    • Identify rare codons that may cause ribosomal pausing

    • Consider synthetic gene design with optimized codons while maintaining key regulatory elements

  • Protein Stability Enhancement Strategies:

IssueDiagnostic ApproachSolution StrategyExpected Outcome
Poor solubilityTest expression at different temperaturesLower temperature (16-20°C)Reduced inclusion body formation
Proteolytic degradationWestern blot time-course analysisAdd protease inhibitors, use protease-deficient strainsIntact protein detection
Toxicity to hostGrowth curve comparisonUse tightly controlled inducible promotersBetter cell growth before induction
Improper foldingLimited proteolysis assayInclude molecular chaperones (GroEL/ES)Increased proportion of properly folded protein
Membrane integration issuesFractionation analysisTry different detergents for extractionImproved recovery from membrane fraction
  • Expression Vector Optimization:

    • Test multiple fusion tags (His6, MBP, SUMO, GST) to identify optimal solubility enhancement

    • Evaluate different promoter strengths and induction systems

    • Consider dual-vector systems for co-expression with assembly partners

    • Design constructs with and without predicted transit peptides

  • Host Strain Selection:

    • For E. coli expression: Compare BL21(DE3), C41(DE3), C43(DE3), and Rosetta strains

    • For yeast expression: Test Pichia pastoris versus Saccharomyces cerevisiae

    • For insect cell expression: Compare Sf9 versus High Five cells

    • For plant expression: Evaluate transient (N. benthamiana) versus stable transformation

  • Systematic Troubleshooting Protocol:

    • Start with small-scale expression tests (10-50 mL cultures)

    • Analyze total, soluble, and insoluble fractions by SDS-PAGE and western blotting

    • Optimize induction parameters (inducer concentration, time, temperature, OD at induction)

    • Screen multiple lysis/extraction buffers with different detergents and salt concentrations

    • Consider co-expression with interaction partners from the NDH complex

  • Advanced Rescue Techniques:

    • In vitro protein refolding from inclusion bodies

    • Cell-free expression systems

    • Fusion to self-splicing inteins for native protein recovery

    • Nanodiscs or liposomes for membrane protein stabilization

By methodically addressing these factors, researchers can identify and overcome specific challenges in the expression of recombinant ndhE protein, moving from troubleshooting to optimal production protocols .

How should researchers interpret contradictory data regarding ndhE function in different experimental systems?

When encountering contradictory data regarding ndhE function across different experimental systems, researchers should employ a structured analytical approach:

  • System-Specific Variables Assessment:

    • Create a comprehensive comparison table of experimental conditions:

Experimental SystemOrganism/Cell TypeGrowth ConditionsMeasurement TechniquesKey FindingsPotential Confounding Factors
In vitro reconstitutionPurified proteinsDefined buffer compositionSpectrophotometric assaysDirect enzymatic activityAbsence of native membrane environment
Bacterial expressionE. coliAerobic/anaerobic growthOxygen consumption, NAD(P)H oxidationHeterologous functionDifferent quinone species present
Yeast systemS. cerevisiaeFermentative/respiratoryGrowth complementationIn vivo functionMitochondrial vs. chloroplastic targeting
Plant systemNative potatoVariable light/stressChlorophyll fluorescence, gas exchangePhysiological roleComplex genetic background
  • Meta-Analysis Protocol:

    • Systematically evaluate methodological differences between studies

    • Assess statistical power and experimental design rigor

    • Consider physiological context of measurements (stress conditions, developmental stage)

    • Evaluate whether contradictions reflect genuine biological variation or technical artifacts

  • Resolution Strategies:

    • Design experiments that bridge different systems (e.g., express plant ndhE in bacteria, then reintroduce to plant mutants)

    • Use multiple independent techniques to measure the same parameter

    • Implement time-resolved measurements to capture dynamic responses

    • Develop computational models that can account for system-specific variables

  • Interpretation Framework:

    • Start with the assumption that contradictions reflect real biological complexity rather than experimental error

    • Consider that ndhE may have multiple functions depending on cellular context

    • Evaluate whether post-translational modifications present in some systems but not others explain functional differences

    • Assess whether interaction partners essential for native function are present in all systems being compared

  • Reconciliation Approach:

    • Formulate a unifying hypothesis that accommodates seemingly contradictory observations

    • Design critical experiments specifically to test this unifying hypothesis

    • Use structure-function analyses to identify domains responsible for context-specific activities

    • Consider evolutionary context and phylogenetic analyses to explain functional divergence

By applying this structured approach, researchers can transform apparent contradictions into deeper insights about context-dependent functions of ndhE and the regulatory mechanisms that govern its activity across different experimental systems .

What statistical approaches are most appropriate for analyzing phenotypic data from potato plants with modified ndhE expression?

When analyzing phenotypic data from potato plants with modified ndhE expression, selecting appropriate statistical approaches is crucial for robust interpretation:

  • Experimental Design Considerations:

    • For field experiments: Use randomized complete block design (RCBD) to account for environmental gradients

    • For controlled environment studies: Completely randomized design (CRD) is appropriate

    • Ensure minimum three biological replicates and multiple technical replicates per measurement

    • Include appropriate controls (wild-type, empty vector controls, other NDH subunit modifications)

  • Primary Statistical Analyses:

Data TypeRecommended TestPrerequisitesFollow-up Tests
Continuous variables (growth, yield)ANOVA or Mixed ModelsNormal distribution, homogeneity of varianceTukey's HSD or Bonferroni for multiple comparisons
Time-series data (photosynthetic parameters)Repeated Measures ANOVASphericity (Mauchly's test)Post-hoc trend analysis
Count data (tuber number)Generalized Linear Models (Poisson distribution)Check for overdispersionChi-square goodness-of-fit
Proportional data (survival rates)Beta regressionData between 0-1, not at extremesLikelihood ratio tests
  • Multivariate Approaches:

    • Principal Component Analysis (PCA) to identify patterns in multidimensional phenotypic data

    • Hierarchical clustering to group genotypes with similar responses

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify variables that discriminate between genotypes

    • Canonical Correlation Analysis (CCA) to relate environmental variables to phenotypic responses

  • Advanced Modeling Approaches:

    • Linear mixed models to account for random effects in field trials

    • Structural equation modeling to test hypothesized causal relationships

    • Bayesian network analysis to discover probabilistic relationships between variables

    • Machine learning approaches (random forests, support vector machines) for predictive modeling

  • Statistical Power Considerations:

    • Conduct power analysis to determine adequate sample sizes

    • For subtle phenotypes, increase replication to detect small effects

    • Consider hierarchical sampling design for nested variables

    • Report effect sizes alongside p-values for more meaningful interpretation

  • Handling Environmental Interactions:

    • Use AMMI (Additive Main Effects and Multiplicative Interaction) models for genotype × environment interactions

    • Apply GGE (Genotype and Genotype by Environment) biplots to visualize stability across environments

    • Implement factorial ANOVA to test specific environmental variables (light, temperature, drought)

By implementing these statistical approaches appropriately, researchers can robustly analyze complex phenotypic data from potato plants with modified ndhE expression, distinguishing true biological effects from experimental variation and identifying key physiological impacts of ndhE modification under various environmental conditions .

How can bioinformatic approaches be used to predict the impact of ndhE mutations on NDH complex assembly and function?

Bioinformatic approaches offer powerful tools for predicting the effects of ndhE mutations on NDH complex assembly and function:

  • Structural Prediction Pipeline:

    • Homology modeling using related structures from cyanobacteria or other plants

    • Ab initio modeling for regions lacking homologous templates

    • Molecular dynamics simulations to assess structural stability

    • Protein-protein docking to predict interactions with other NDH subunits

  • Sequence-Based Analysis:

ApproachTool ExamplesApplication to ndhEExpected Insights
Conservation analysisConSurf, Rate4SiteIdentify evolutionarily conserved residuesLikely functional importance of specific amino acids
Coevolution analysisEVcouplings, RaptorXDetect correlated mutations across speciesPotential interaction interfaces
Disorder predictionPONDR, IUPredIdentify flexible regions in ndhEPotential regulatory domains
Transmembrane topologyTMHMM, PhobiusPredict membrane-spanning regionsStructural organization within membrane
  • Mutation Impact Prediction:

    • Use tools like PROVEAN, SIFT, and PolyPhen-2 to predict functional impacts of point mutations

    • Apply energy calculation methods to assess destabilizing effects of mutations

    • Model electrostatic changes that might affect quinone binding or electron transfer

    • Simulate the effects of mutations on protein flexibility and conformational dynamics

  • Systems Biology Approaches:

    • Network analysis to identify potential compensatory mechanisms

    • Flux balance analysis to predict effects on electron flow

    • Gene co-expression analysis to identify functionally related genes

    • Pathway enrichment analysis to predict broader physiological impacts

  • Machine Learning Integration:

    • Train predictive models using existing NDH complex mutant data

    • Develop feature extraction methods specific to membrane protein complexes

    • Implement deep learning approaches for mutation effect prediction

    • Use ensemble methods to combine multiple predictive algorithms

  • Visualization and Interpretation:

    • Create comprehensive mutation maps highlighting critical functional regions

    • Develop interactive 3D visualizations of predicted structural changes

    • Generate residue interaction networks to identify key structural nodes

    • Produce mutation tolerance profiles for different regions of ndhE

  • Validation Design:

    • Use bioinformatic predictions to design targeted mutagenesis experiments

    • Prioritize mutations for experimental testing based on predicted impact

    • Develop computational-experimental feedback loops to refine predictive models

    • Integrate results from multiple organisms to strengthen predictions

By implementing these bioinformatic approaches, researchers can generate testable hypotheses about the impact of specific ndhE mutations, guiding experimental design and providing mechanistic insights into how sequence changes affect NDH complex assembly, stability, and function across different environmental conditions.

What are the emerging technologies that might advance research on recombinant ndhE in the next five years?

Several cutting-edge technologies are poised to transform research on recombinant ndhE in the near future:

  • Advanced Structural Biology Techniques:

    • Cryo-electron tomography for in situ visualization of NDH complexes within thylakoid membranes

    • Integrative structural biology combining cryo-EM, crosslinking-MS, and computational modeling

    • Time-resolved X-ray crystallography to capture intermediate states during electron transfer

    • Single-particle analysis at higher resolution to reveal detailed subunit interactions

  • Genome Engineering Advancements:

    • Base editing technologies for precise single nucleotide modifications without double-strand breaks

    • Prime editing for targeted insertion of specific mutations in chloroplast genomes

    • Multiplex CRISPR systems for simultaneous editing of multiple NDH subunits

    • Inducible/reversible gene expression systems for temporal control of ndhE function

  • Single-Cell and Subcellular Analysis:

    • Single-chloroplast proteomics to analyze variation in NDH complex composition

    • Super-resolution microscopy for nanoscale localization of NDH complexes in thylakoids

    • Correlative light and electron microscopy to link structure and function

    • Microfluidic approaches for high-throughput phenotyping of plant cells

  • Real-Time Measurement Technologies:

    • Genetically encoded biosensors for NAD(P)H/NAD(P)+ ratio monitoring in chloroplasts

    • Electron paramagnetic resonance (EPR) spectroscopy for detecting electron transfer intermediates

    • Ultrafast spectroscopy to capture electron movement through the NDH complex

    • Label-free imaging techniques for non-invasive monitoring of photosynthetic parameters

  • Synthetic Biology Approaches:

    • De novo design of simplified NDH complexes with defined functions

    • Creation of synthetic electron transport chains with novel properties

    • Engineering orthogonal redox systems in chloroplasts

    • Development of optogenetic tools to control NDH complex activity with light

  • Advanced Computational Approaches:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of electron transfer

    • Whole-cell models incorporating NDH function in photosynthetic metabolism

    • Artificial intelligence for predicting optimal ndhE variants for specific conditions

    • Molecular dynamics at extended timescales to capture conformational changes

  • Translational Applications:

    • High-throughput screening platforms for identifying plants with enhanced NDH function

    • Field-deployable sensors for monitoring NDH activity in crop plants

    • Bioengineering approaches to enhance cyclic electron flow for improved crop resilience

    • Development of synthetic plant systems with redesigned electron transport chains

These emerging technologies will enable unprecedented insights into ndhE function, potentially leading to engineered crops with enhanced photosynthetic efficiency, particularly under stress conditions where cyclic electron flow plays a critical role.

What are the most significant unresolved questions regarding the structure-function relationship of ndhE in potato chloroplasts?

Despite substantial progress in understanding NDH complexes, several critical questions regarding the structure-function relationship of ndhE in potato chloroplasts remain unresolved:

  • Structural Integration Questions:

    • What is the precise topology of ndhE within the membrane domain of the NDH complex?

    • Which amino acid residues in ndhE are critical for interaction with other NDH subunits?

    • How does ndhE contribute to the stability of the entire NDH complex?

    • What structural changes occur in ndhE during electron transport and proton pumping?

  • Functional Mechanism Uncertainties:

    • Does ndhE directly participate in electron transfer or solely play a structural role?

    • What is the exact electron pathway through the NDH complex involving ndhE?

    • How do post-translational modifications of ndhE regulate NDH complex activity?

    • What is the stoichiometry of proton translocation per electron in the NDH complex?

  • Regulatory Aspects:

    • How is ndhE expression regulated in response to environmental stresses?

    • What signaling pathways control NDH complex assembly involving ndhE?

    • Does ndhE undergo dynamic association/dissociation with the complex under different conditions?

    • How do interactions between chloroplast and nuclear genomes coordinate ndhE function?

  • Evolutionary Considerations:

    • Why has ndhE been retained in the chloroplast genome while other components moved to the nucleus?

    • How has the structure-function relationship of ndhE evolved across different plant lineages?

    • What can comparative genomics tell us about ndhE conservation and diversification?

    • Are there unique features of potato ndhE compared to other crop species?

  • Integration with Photosynthetic Machinery:

    • How does ndhE-containing NDH complex physically interact with photosystem I?

    • What is the spatial distribution of NDH complexes relative to other thylakoid complexes?

    • How does ndhE contribute to supercomplexes involved in cyclic electron flow?

    • What is the relationship between NDH-dependent and PGR5-dependent cyclic electron flow pathways?

Addressing these unresolved questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. These investigations will not only advance our fundamental understanding of photosynthetic electron transport but may also provide insights for engineering crops with enhanced performance under challenging environmental conditions .

How might advances in understanding ndhE function contribute to improving stress tolerance in potato crops?

Advances in understanding ndhE function could significantly contribute to improving stress tolerance in potato crops through several mechanistic pathways:

  • Enhanced Photoprotection Under Stress:

    • The NDH complex containing ndhE plays a critical role in cyclic electron flow (CEF), which helps dissipate excess light energy

    • By optimizing ndhE function, researchers could enhance photoprotection mechanisms under high light or temperature stress

    • This would reduce photoinhibition and oxidative damage, maintaining photosynthetic efficiency under adverse conditions

  • Improved Energy Balance:

    • NDH-mediated cyclic electron flow contributes to ATP synthesis without net NADPH production

    • Optimized ndhE function could help maintain optimal ATP:NADPH ratios during stress

    • This balanced energy production supports carbon fixation and photorespiration under fluctuating conditions

  • Drought Tolerance Enhancement:

    • During drought stress, plants typically close stomata, limiting CO₂ uptake

    • Enhanced NDH function could help maintain proton gradient and ATP synthesis when linear electron flow is restricted

    • This provides energy for osmotic adjustment and reactive oxygen species (ROS) detoxification pathways

  • Application Strategies Table:

StrategyApproachExpected OutcomeImplementation Challenges
Overexpression of optimized ndhEChloroplast transformationEnhanced CEF capacityEnsuring proper integration into NDH complex
Promoter engineeringStress-inducible expressionDynamic upregulation during stressAchieving organelle-specific regulation
Structure-based engineeringTargeted amino acid substitutionsImproved electron transfer efficiencyPredicting beneficial modifications
NDH-PSI supercomplex enhancementCo-engineering interaction partnersStabilized CEF machineryComplex multigenic modifications
Transcription factor modulationUpregulation of entire NDH pathwayCoordinated enhancement of all componentsAvoiding negative pleiotropic effects
  • Field Performance Impacts:

    • Improved heat stress tolerance, particularly important as global temperatures rise

    • Enhanced recovery from drought cycles, critical for rain-fed potato cultivation

    • Better performance under fluctuating light conditions, relevant for field environments

    • Potential yield stability under suboptimal growing conditions

  • Translational Research Pathway:

    • Identify naturally occurring ndhE variants associated with stress tolerance

    • Screen wild potato relatives for enhanced NDH function under stress

    • Develop molecular markers for stress-tolerant NDH alleles

    • Implement precision breeding or genome editing to introduce beneficial ndhE variants

  • Agronomic Benefits:

    • Reduced yield losses under unpredictable weather patterns

    • Expanded potential growing regions for potato cultivation

    • Decreased irrigation requirements

    • Improved resilience to climate change impacts

By targeting ndhE and the NDH complex, researchers could enhance a fundamental aspect of photosynthetic energy balance that is especially critical under stress conditions. This represents a promising approach for developing climate-resilient potato varieties with stable yields under increasingly challenging agricultural conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.