Recombinant Solanum tuberosum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction

The psbB gene encodes the CP47 subunit, a core chlorophyll-binding protein in Photosystem II (PSII), critical for light-driven water oxidation in plants and cyanobacteria . Recombinant Solanum tuberosum (potato) psbB represents a bioengineered version of this protein, produced via heterologous expression systems (e.g., E. coli) for research and biotechnological applications . This article synthesizes structural, functional, and experimental data to elucidate its role and utility.

Physicochemical Properties

ParameterDetail
StabilityHalf-life: ~15 hours in cyanobacteria (CP47 analog) . Lyophilization enhances shelf life.
Buffer CompatibilityCompatible with Tris/PBS-based buffers; trehalose (6%) stabilizes protein structure .
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Turnover Dynamics

In Synechocystis, CP47 exhibits a half-life of 15 hours, indicating slower turnover compared to the D1 protein (1.5 hours) . This stability is vital for PSII repair mechanisms.

Biotechnological Tools

  • ELISA Kits: Recombinant psbB serves as an antigen for developing antibodies to detect PSII integrity .

  • Plastid Engineering: Insights from psbB expression in E. coli inform strategies for enhancing protein yields in chloroplasts .

Comparative Analysis of Recombinant psbB Across Species

SpeciesUniProt IDExpression HostTagKey Application
Solanum tuberosumQ2VEF4E. coliHisELISA, structural studies
Populus albaQ14FD1E. coliHisPSII complex reconstitution
Cyanophora paradoxaP48103E. coliN/AEvolutionary studies

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order for preferential development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Solanum tuberosum (Potato)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function

Recombinant Solanum tuberosum Photosystem II CP47 chlorophyll apoprotein (psbB) is a core component of the photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient essential for ATP synthesis.

Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CP47 chlorophyll apoprotein (psbB) in photosynthesis?

The CP47 protein serves as an integral antenna of the oxygen-evolving photosystem II (PSII) complex, responsible for efficient excitation energy transfer to the PSII reaction center. This transfer initiates the charge separation that drives the electron transfer cascade in oxygenic photosynthesis. The protein binds chlorophyll molecules that capture light energy and funnel it to the reaction center, making it a critical component of the photosynthetic apparatus . The CP47 protein contains 16 chlorophyll molecules whose structural arrangement and electronic properties define the mechanisms of energy transfer within the photosystem .

What is the genomic location and organization of the psbB gene in potato chloroplasts?

The psbB gene is located in the chloroplast genome of Solanum tuberosum. The full sequence of the cultivated potato chloroplast genome has been determined, providing comprehensive information about the organization of plastid genes including psbB . The gene encodes a protein of 508 amino acids that functions as part of the photosystem II complex. Researchers can access specific genetic information using the UniProt ID Q2VEF4 for further sequence analysis and comparative genomic studies .

How do expression levels of psbB differ between chloroplasts and amyloplasts in potato?

Studies on plastid gene expression in potato have revealed significant differences in transcript levels between chloroplasts (in leaves) and amyloplasts (in tubers). Transcripts of photosynthesis genes, including those encoding subunits of PSII, PSI, and the ATP synthase complex, are abundantly expressed in leaves but barely detectable in tubers . These differences reflect the distinct functional roles of the two plastid types - photosynthesis in chloroplasts versus starch storage in amyloplasts. Northern-blot analyses have confirmed these expression patterns, with photosynthesis-related genes showing markedly lower expression in tubers compared to leaves .

What expression systems are most effective for producing recombinant potato CP47 protein?

E. coli expression systems have been successfully employed for recombinant production of the Solanum tuberosum Photosystem II CP47 chlorophyll apoprotein. Specifically, the full-length protein (amino acids 1-508) can be expressed with an N-terminal His tag to facilitate purification . This approach allows researchers to obtain the protein in sufficient quantities for structural and functional studies. The resulting protein is typically lyophilized and can be reconstituted in appropriate buffers for downstream applications .

What are the optimal storage conditions for recombinant CP47 protein?

Recombinant CP47 protein is typically stored as a lyophilized powder at -20°C/-80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity . When reconstituting the protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (with 50% being the standard recommendation) followed by aliquoting and storage at -20°C/-80°C is advised .

What buffer systems are recommended for maintaining CP47 protein stability?

Tris/PBS-based buffer systems at pH 8.0 containing 6% trehalose have been shown to effectively maintain the stability of recombinant CP47 protein . Trehalose serves as a cryoprotectant and stabilizing agent during freeze-thaw cycles. When reconstituting the protein from lyophilized form, brief centrifugation prior to opening is recommended to bring the contents to the bottom of the vial. For experimental applications requiring different buffer conditions, researchers should employ gradual buffer exchange methods to avoid protein denaturation .

How does the structure of CP47 contribute to energy transfer in photosystem II?

The CP47 protein contains 16 chlorophyll molecules whose spatial arrangement and electronic properties are critical for efficient excitation energy transfer to the PSII reaction center . Quantum mechanics/molecular mechanics (QM/MM) studies utilizing time-dependent density functional theory have been employed to map the distribution of site energies among these chlorophylls, providing insights into the mechanism of excitation energy transfer . Recent research has identified specific chlorophylls (particularly B3, followed by B1) as the most red-shifted within the complex, challenging previous hypotheses in the literature . This structural arrangement facilitates the directional transfer of excitation energy toward the reaction center, where charge separation initiates the electron transfer cascade of photosynthesis.

What spectroscopic methods are most informative for studying CP47 function?

For studying CP47 function, several spectroscopic approaches provide valuable information:

  • Absorption spectroscopy: Identifies the characteristic chlorophyll absorption bands and their shifts when bound to the protein.

  • Fluorescence spectroscopy: Measures energy transfer efficiency and can identify rate-limiting steps in the transfer process.

  • Circular dichroism: Provides information on protein secondary structure and pigment organization.

  • Time-resolved spectroscopy: Captures the dynamics of energy transfer on picosecond and femtosecond timescales.

Multiscale quantum mechanics/molecular mechanics (QM/MM) approaches utilizing time-dependent density functional theory have proven particularly valuable for computing the excitation energies of all CP47 chlorophylls and understanding the electrostatic effects of the protein environment on chlorophyll site energies .

What is known about CP47 protein stability under different experimental conditions?

Molecular dynamics simulations of isolated CP47 have been used to evaluate structural stability under various experimental conditions . This is particularly relevant given that many experimental studies utilize extracted samples rather than examining the protein in its native membrane environment. Research has demonstrated that the protein exhibits greater structural flexibility when isolated compared to its state within the complete membrane-embedded photosystem II complex . This has important implications for interpreting experimental results obtained from isolated samples and emphasizes the need to consider the native environment when evaluating protein function.

How can researchers effectively study promoter utilization in the psbB gene?

Promoter utilization in the psbB gene can be studied using primer extension analysis to map the 5′ ends of transcripts . This approach allows researchers to characterize promoter usage patterns and detect possible differences between various tissue types (e.g., chloroplasts and amyloplasts). While the psbB gene primarily utilizes PEP (plastid-encoded RNA polymerase) promoters, comprehensive analysis should include comparison with genes containing both PEP and NEP (nuclear-encoded RNA polymerase) promoters, such as rrn16 and clpP . The experimental protocol typically involves:

  • RNA extraction from different tissue types

  • Primer design complementary to sequences downstream of putative promoters

  • Reverse transcription with labeled primers

  • Resolution of extension products on sequencing gels

  • Comparison with sequencing ladders to precisely map transcription start sites

What approaches are recommended for studying CP47 protein-protein interactions within PSII?

Several complementary approaches can be employed to study CP47 protein-protein interactions within the PSII complex:

  • Co-immunoprecipitation: Using antibodies against CP47 to pull down interaction partners

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify proximity relationships

  • Yeast two-hybrid screens: For specific binary interactions with candidate proteins

  • Blue native gel electrophoresis: To isolate intact PSII complexes and subcomplexes

  • Cryo-electron microscopy: For structural determination of the entire PSII complex at high resolution

These methods should be combined with mutational analyses to validate the functional significance of identified interactions. Research has shown that CP47 forms crucial interactions with the reaction center proteins and plays a structural role in the organization of the oxygen-evolving complex .

What are the best methods for quantifying psbB transcript levels in different tissues?

To quantify psbB transcript levels across different tissues, researchers have successfully employed:

  • Microarray analysis: Using spotted oligonucleotides designed from the potato chloroplast genome sequence to analyze expression of all plastid genes simultaneously

  • Northern blot analysis: For validation of microarray results and detailed characterization of transcript sizes and abundance

  • Quantitative real-time PCR (qRT-PCR): For highly sensitive quantification of specific transcripts

  • RNA-Seq: For comprehensive transcriptome profiling and detection of novel transcripts

When comparing transcript levels between different plastid types (e.g., chloroplasts and amyloplasts), it is essential to normalize data appropriately and consider variation in plastome copy number, which may contribute to observed differences in transcript abundance .

How does CP47 contribute to the excitation energy profile of PSII, and what computational methods best capture these properties?

The CP47 antenna complex plays a critical role in shaping the excitation energy landscape of PSII through the specific arrangement and electronic coupling of its 16 chlorophyll molecules . Advanced computational approaches to characterize these properties include:

Computational MethodApplicationAdvantages
QM/MM with TD-DFTExcitation energy calculationAccounts for protein electrostatic effects
Range-separated functionalsElectronic couplingImproved description of charge-transfer states
Molecular dynamicsStructural flexibilityCaptures thermal fluctuations
Exciton Hamiltonian modelsEnergy transfer dynamicsEfficient for large systems

Research using these methods has revealed that the chlorophylls designated B3 and B1 have the most red-shifted excitation energies, contrary to some previous literature hypotheses . The electrostatic effect of the protein environment significantly influences these site energies, highlighting the importance of studying CP47 in its native context within a complete computational model of cyanobacterial PSII .

What factors contribute to differences in psbB transcript processing between chloroplasts and amyloplasts?

Research has identified several factors that contribute to differential psbB transcript processing between chloroplasts and amyloplasts:

  • Promoter utilization: Different usage patterns of PEP and NEP promoters between the two plastid types

  • Transcript splicing: Differences in the efficiency of intron removal from primary transcripts

  • mRNA editing: Variation in the sites and extent of C-to-U editing in transcripts

  • Polysome loading: Differences in translation efficiency as measured by association with polysomes

These differences reflect the distinct functional requirements of the two organelle types, with chloroplasts optimized for photosynthesis and amyloplasts specialized for starch storage. Understanding these tissue-specific differences provides insights into the regulatory mechanisms controlling plastid gene expression during plant development and differentiation .

How can next-generation sequencing approaches improve our understanding of CP47 and psbB genetic variation across potato varieties?

Next-generation sequencing techniques offer powerful approaches for investigating CP47/psbB variation:

  • Long-read sequencing (PacBio or Nanopore): Essential for correctly assembling the inverted repeat (IR) regions of chloroplast genomes, which traditional short-read methods often misassemble . Recent evidence shows that terrestrial plant plastomes can exhibit two structural haplotypes with different IR orientations, highlighting the importance of long-read technology .

  • Hybrid sequencing strategies: Combining long reads (for structural information) with short reads (for error correction) provides an optimal approach to plastome assembly and analysis .

  • Population-scale sequencing: Allows characterization of psbB variation across different potato cultivars and wild relatives, providing insights into evolutionary adaptation.

  • RNA-Seq: Enables comprehensive transcriptome analysis to detect splicing variants and expression differences across tissues and developmental stages.

These advanced sequencing approaches overcome limitations of traditional methods, particularly in resolving complex structural features of chloroplast genomes and identifying rare variants that may influence CP47 function and photosynthetic efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.