Recombinant Solanum tuberosum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we have in stock, we are open to fulfilling your specific requirements for the format. Please indicate your preferred format in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Solanum tuberosum (Potato)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient that drives ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what does it encode in Solanum tuberosum?

The psbA gene in Solanum tuberosum (potato) encodes the D1 protein, one of the two main subunits of the reactive center core of Photosystem II (PSII). The D1 protein, together with D2, forms the heart of PSII's oxidizing functionality. As a critical component of the photosynthetic apparatus, D1 plays an essential role in the light-dependent reactions of photosynthesis, particularly in the water-splitting complex that generates oxygen . Research has shown that the psbA gene can be significantly upregulated (up to 2.9-fold) in response to certain treatments such as chitosan application, indicating its dynamic expression patterns in response to environmental stimuli .

How is the psbA gene structurally organized in the potato chloroplast genome?

In Solanum tuberosum, the psbA gene is located in the chloroplast genome and consists of multiple exons and introns. While the search results don't provide the exact structure for potato specifically, we can gain insights from related research. In Chlamydomonas reinhardtii, for example, the psbA gene contains at least four exons separated by introns . The coding regions (exons) contain the sequence information for the D1 protein, while the non-coding introns are removed during RNA processing. The structural organization of psbA is important for researchers designing targeted genetic modifications, as demonstrated in transformation approaches that target specific exons flanked by intronic regions .

What is the functional significance of the D1 protein encoded by psbA in photosynthesis?

The D1 protein encoded by psbA has several critical functions in photosynthesis:

  • Core component of PSII: D1 forms the reaction center core of PSII along with the D2 protein, housing the primary electron donors and acceptors .

  • Oxidation catalyst: As part of PSII, which is the strongest known natural oxidizing agent, D1 participates in the initial light-driven electron transfer reactions .

  • High turnover requirement: Due to its exposure to oxidative damage, D1 has a shorter lifetime compared to other photosynthetic components, necessitating higher turnover rates to maintain photosynthetic efficiency .

  • Electron transport mediator: D1 contains binding sites for cofactors involved in electron transport, including the pheophytin (Pheo) that serves as an electron acceptor in the electron transport chain .

How do post-translational modifications affect D1 protein functionality in Solanum tuberosum under various stress conditions?

Post-translational modifications (PTMs) of the D1 protein play crucial roles in regulating its functionality, particularly under stress conditions. While the search results don't provide potato-specific PTM data, research on related species offers valuable insights. In cyanobacteria, specific amino acid residues in D1 are critical for its function. For instance, changes in hydrogen bonding patterns involving D1-130 and D1-147 affect the redox potential and stability of the associated pheophytin (Pheo D1) .

Under stress conditions, the D1 protein undergoes increased turnover due to oxidative damage. The replacement of damaged D1 involves proteolytic degradation followed by insertion of newly synthesized D1 proteins. This repair cycle is critical for maintaining photosynthetic efficiency under stress conditions.

For experimental investigation of D1 PTMs in potatoes, researchers should consider:

  • Phosphorylation analysis using mass spectrometry

  • Comparison of PTM patterns between normal and stressed conditions (heat, light, drought)

  • Site-directed mutagenesis of potential PTM sites to evaluate functional significance

These approaches would help elucidate how potato D1 protein is regulated post-translationally to cope with environmental stresses .

What strategies can be employed for targeted mutagenesis of the psbA gene in Solanum tuberosum, and what are their relative efficiencies?

Based on successful approaches in other photosynthetic organisms, several strategies can be employed for targeted mutagenesis of the psbA gene in S. tuberosum:

  • Homologous recombination-based approach: This method has proven effective in Chlamydomonas reinhardtii, where targeted replacement of specific exons was achieved using linear DNA fragments homologous to the target region. This approach could be adapted for potato by:

    • Co-transformation with antibiotic resistance markers

    • Using FUDR treatment to reduce chloroplast DNA copy number prior to transformation

    • Designing PCR-amplified linear DNA fragments with the desired mutations flanked by homologous regions

  • CRISPR-Cas9 chloroplast genome editing: Though not mentioned in the search results, recent advances in CRISPR technology for chloroplast genomes could be applied to potato psbA.

  • Biolistic transformation with modified psbA fragments: This technique has been successfully used in C. reinhardtii and could be optimized for potato chloroplasts .

Efficiency considerations include:

  • Selection marker choice (spectinomycin resistance has proven effective)

  • Homology arm length (longer arms generally increase efficiency)

  • Screening strategy (restriction site modification can facilitate identification)

  • Homoplasmicity achievement (multiple selection rounds may be needed)

For screening transformants, a strategy similar to that used for C. reinhardtii could be employed, where restriction sites are modified along with the mutation of interest to facilitate identification through restriction analysis of PCR products .

How do the structural differences between wild-type and recombinant variants of the psbA-encoded D1 protein impact electron transport chain efficiency?

Structural differences between wild-type and recombinant variants of the D1 protein can significantly impact electron transport chain (ETC) efficiency through several mechanisms:

  • Alterations in redox potential: Amino acid substitutions can modify the redox potential of electron carriers. For example, in cyanobacteria, the change from Gln to Glu at position D1-130 strengthens the hydrogen bond with pheophytin, increasing its redox potential . In potato, similar mutations could be engineered to modulate electron transfer rates.

  • Stability of cofactor binding: Mutations affecting hydrogen bonding networks can impact the stability of cofactors like pheophytin. In cyanobacterial PsbA2, the Y147F change results in the loss of a hydrogen bond to pheophytin, decreasing its stability . Similar modifications in potato D1 would likely affect ETC efficiency.

  • Channel structure modifications: Amino acid changes can alter important channels in the protein. For instance, in cyanobacterial PsbA2, the P173M change narrows the Cl-1 channel, affecting the efficiency of S-state transitions beyond S2 . This demonstrates how subtle structural changes can have significant functional consequences.

  • Plastoquinone exchange efficiency: The interaction between D1 and plastoquinone is critical for electron transport. In cyanobacteria, the S270A change in PsbA3 disrupts a hydrogen bond with a sulfoquinovosyl-diacylglycerol molecule near the QB site, potentially facilitating plastoquinone exchange and enhancing oxygen evolution .

These insights from cyanobacterial research provide valuable guidance for designing recombinant potato D1 variants with enhanced electron transport properties. Researchers working with potato should consider targeting these key residues when engineering D1 proteins with improved photosynthetic efficiency or stress tolerance .

What are the most effective protocols for isolating and purifying recombinant psbA protein from Solanum tuberosum?

While the search results don't provide a direct protocol for isolating recombinant psbA protein from potatoes, an effective methodology can be developed based on established techniques for photosystem proteins:

  • Chloroplast Isolation

    • Homogenize fresh potato leaves in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.8, 2 mM EDTA, 1 mM MgCl₂, 5 mM ascorbate)

    • Filter through miracloth and centrifuge at 1,000 × g for 5 minutes

    • Resuspend and purify chloroplasts on a Percoll gradient

  • Thylakoid Membrane Preparation

    • Lyse chloroplasts in hypotonic buffer (10 mM HEPES-KOH pH 7.8, 5 mM MgCl₂)

    • Centrifuge at 10,000 × g for 10 minutes to collect thylakoid membranes

    • Wash membranes with buffer containing 25 mM HEPES-KOH pH 7.8, 10 mM EDTA

  • Photosystem II Particle Isolation

    • Solubilize thylakoid membranes with n-dodecyl-β-D-maltoside (0.5-1%)

    • Separate PSII particles by sucrose gradient ultracentrifugation

  • D1 Protein Purification

    • Further purify D1 protein using ion exchange chromatography

    • Verify protein integrity by Western blotting using D1-specific antibodies

For recombinant D1 protein expressed in heterologous systems, additional steps including affinity chromatography with appropriate tags would be necessary. When working with recombinant variants, researchers should consider the structural implications of mutations on protein stability and adjust purification conditions accordingly. The high turnover rate and susceptibility to oxidative damage of D1 protein necessitates working under reduced light conditions and with antioxidants throughout the purification process .

What methods can be employed to assess the functional impact of targeted mutations in the psbA gene on photosynthetic efficiency?

To comprehensively assess the functional impact of targeted psbA mutations on photosynthetic efficiency, researchers should employ multiple complementary methodologies:

  • Oxygen Evolution Measurements

    • Clark-type oxygen electrode measurements under varying light intensities

    • Analysis of oxygen evolution rates in the presence of specific electron acceptors/donors

    • Comparison of oxygen evolution kinetics between wild-type and mutant lines

  • Chlorophyll Fluorescence Analysis

    • Pulse-Amplitude-Modulation (PAM) fluorometry to determine:

      • Maximum quantum yield (Fv/Fm)

      • Effective quantum yield (ΦPSII)

      • Non-photochemical quenching (NPQ)

      • Electron transport rate (ETR)

    • Fast fluorescence kinetics (OJIP test) to assess specific steps in electron transport

  • Spectroscopic Techniques

    • Absorption spectroscopy to analyze changes in pigment-protein interactions

    • Thermoluminescence to assess charge recombination events

    • EPR spectroscopy to detect changes in the redox state of electron carriers

  • Biochemical Analyses

    • Western blotting to assess D1 protein turnover rates

    • Blue native PAGE to analyze protein complex assembly

    • Measurement of reactive oxygen species (ROS) production

  • Stress Response Testing

    • Evaluate photosynthetic parameters under various stress conditions (high light, temperature extremes, drought)

    • Recovery kinetics after photoinhibition

    • Long-term growth and biomass accumulation measurements

Data integration table for comprehensive mutation assessment:

ParameterTechniqueWild-typeMutant% ChangeSignificance
O₂ evolutionClark electrodeX mg O₂/mg Chl/hY mg O₂/mg Chl/hZ%p-value
ΦPSIIPAM fluorometryXYZ%p-value
D1 turnoverPulse-chaseX minY minZ%p-value
ROS productionDCFH-DA fluorescenceX RFUY RFUZ%p-value
Growth rateBiomass accumulationX g/dayY g/dayZ%p-value

How can researchers distinguish between direct effects of psbA mutations and compensatory responses in transcriptomic data?

Distinguishing between direct effects of psbA mutations and compensatory responses in transcriptomic data requires a systematic analytical approach:

  • Temporal Analysis Framework

    • Conduct time-series RNA sequencing after introducing mutations

    • Early responses (2-5 hours post-treatment) often reflect direct effects, while later changes (24+ hours) may represent compensatory responses

    • Compare with temporal patterns observed in chitosan treatment studies, which showed 32 differentially expressed genes at 2h and 83 at 5h post-treatment

  • Network Analysis Approach

    • Employ protein-protein interaction (PPI) networks to identify functional relationships

    • Use tools such as STRING to visualize connections between differentially expressed genes

    • Identify co-expression patterns that might indicate coordinated responses

    • Example: The upregulation of genes related to photosystems, electron transport, and ATP synthesis following chitosan treatment demonstrates a connected network response

  • Pathway-Specific Analysis

    • Use tools like MapMan to allocate differentially expressed genes to specific pathways

    • Quantify expression changes within functional categories (e.g., light reaction components vs. stress response genes)

    • Analyze enrichment patterns to identify overrepresented pathways

  • Statistical Methods to Differentiate Response Types

    • Apply principal component analysis (PCA) to identify major sources of variation

    • Use hierarchical clustering to group genes with similar expression patterns

    • Implement differential correlation analysis to identify changes in gene relationships

  • Validation Experiments

    • Conduct RT-qPCR on selected genes at multiple timepoints

    • Use specific inhibitors to block potential compensatory pathways

    • Introduce secondary mutations in putative compensatory genes

By implementing this comprehensive approach, researchers can effectively separate direct consequences of psbA mutations from the broader regulatory responses that may mask or compensate for the primary effects .

What are the key considerations when interpreting electron transport chain measurements in recombinant psbA variants?

When interpreting electron transport chain (ETC) measurements in recombinant psbA variants, researchers should consider several critical factors:

  • Structural Context of Mutations

    • Evaluate how specific amino acid changes affect key interactions:

      • Changes in D1-130 can modify hydrogen bonding with pheophytin, affecting its redox potential

      • Alterations at D1-147 may impact pheophytin stability

      • Mutations at D1-270 can influence QB binding and plastoquinone exchange

    • Consider the three-dimensional context of mutations using available crystal structures

  • Rate-Limiting Step Identification

    • Determine which step in the ETC becomes rate-limiting in mutant variants

    • Compare rates of:

      • Water oxidation at the oxygen-evolving complex

      • Electron transfer from PSII to cytochrome b6f

      • Plastoquinone binding and exchange at the QB site

      • ATP synthesis coupling

  • Integration of Multiple Measurement Techniques

    • Cross-validate findings using different methodologies:

      • Oxygen evolution measurements

      • Chlorophyll fluorescence parameters

      • Spectroscopic techniques (EPR, thermoluminescence)

    • Resolve apparent contradictions by considering the specific aspects of ETC measured by each technique

  • Environmental Context Dependency

    • Test ETC efficiency under multiple conditions:

      • Light intensity variation

      • Temperature gradients

      • Presence of specific stressors

    • Some mutations may show conditional phenotypes only under specific conditions

  • Compensation Mechanisms

    • Assess potential upregulation of alternative electron transport pathways

    • Evaluate changes in cyclic electron flow mediated by the NDH complex

    • Consider alterations in ATP/NADPH ratio requirements

  • Comparative Analysis Framework

    • Compare results to known variants in other species:

      • PsbA1, PsbA2, and PsbA3 variants in cyanobacteria provide reference points

      • Correlation between structural changes and functional consequences observed in other organisms can guide interpretation

This comprehensive interpretative framework helps ensure that the complex data generated from ETC measurements of recombinant psbA variants is accurately understood within the broader context of photosynthetic function .

How can researchers effectively compare homologous psbA genes across different species to inform functional predictions in Solanum tuberosum?

Effectively comparing homologous psbA genes across species requires a systematic approach to translate insights from model organisms to Solanum tuberosum:

  • Sequence-Based Comparative Analysis

    • Perform multiple sequence alignments (MSA) of psbA sequences from diverse species

    • Calculate conservation scores for each amino acid position

    • Identify species-specific variations vs. universally conserved residues

    • Compare specifically with well-studied organisms like cyanobacteria (with differentiated psbA1, psbA2, psbA3 genes) and Chlamydomonas reinhardtii

  • Structural Mapping Approach

    • Map conserved and variable regions onto available 3D structures

    • Identify functionally critical interfaces:

      • Cofactor binding sites

      • Protein-protein interaction surfaces

      • Channel structures for ion and water movement

    • Evaluate how sequence variations might affect these functional elements

  • Functional Domain Cross-Species Comparison

DomainCyanobacteria FeatureCorresponding S. tuberosum FeaturePredicted Functional Impact
Pheophytin bindingH-bond with D1-130 (Glu/Gln)[Corresponding residue]Redox potential modification
QB binding siteD1-270 (Ser/Ala) interaction with SQDG[Corresponding residue]Plastoquinone exchange efficiency
Chloride channelAffected by D1-P173M in PsbA2[Corresponding residue]S-state transition efficiency
  • Evolutionary Analysis Framework

    • Construct phylogenetic trees of psbA sequences

    • Identify lineage-specific adaptations

    • Apply selection pressure analysis (dN/dS ratios) to detect positions under positive selection

    • Use ancestral sequence reconstruction to trace the evolution of key functional changes

  • Experimental Validation Strategy

    • Design chimeric constructs swapping domains between species

    • Create site-directed mutations in S. tuberosum based on insights from other species

    • Use the trnH-psbA region as a DNA barcode for accurate species identification in mixed samples

    • Test functional predictions with in vitro and in vivo assays

By systematically implementing this comparative approach, researchers can leverage the wealth of information from model organisms to make informed predictions about the functional significance of specific residues and regions in potato psbA, guiding more targeted experimental designs .

How can psbA gene engineering be utilized to enhance photosynthetic efficiency and stress tolerance in Solanum tuberosum?

Engineering the psbA gene in Solanum tuberosum presents several strategic approaches for enhancing photosynthetic efficiency and stress tolerance:

  • Targeted D1 Protein Modifications

    • Engineer D1 variants with optimized electron transport properties:

      • Modify the redox potential of cofactors through strategic amino acid substitutions

      • Enhance the stability of pheophytin binding based on cyanobacterial PsbA variants

      • Improve plastoquinone exchange efficiency through modifications at the D1-270 position (corresponding to S270A in cyanobacterial PsbA3)

    • Create variants with enhanced repair efficiency under stress conditions:

      • Modify residues prone to oxidative damage

      • Engineer variants with faster turnover or integration into PSII

  • Regulatory Element Optimization

    • Enhance psbA expression under stress conditions by modifying:

      • Promoter regions for increased transcription

      • 5' UTR elements for improved translation efficiency

      • RNA stability elements to increase transcript half-life

    • Upregulating psbA could compensate for increased photodamage under stress conditions, similar to the 2.9-fold upregulation observed in response to chitosan treatment

  • Integration with Other Photosynthetic Enhancements

    • Coordinate psbA modifications with changes to other components:

      • ATP synthase subunits (atpA, atpB, atpE) to maintain energy balance

      • Cytochrome b6f complex components (petA, petB) to ensure electron flux

      • NDH complex elements to optimize cyclic electron flow under stress

    • This coordinated approach recognizes the interconnected nature of photosynthetic components revealed in transcriptome studies

  • Projected Performance Improvements

Engineering StrategyTarget ParameterExpected ImprovementApplicable Stress Conditions
D1 QB-binding optimizationElectron transport rate15-25%Heat, high light
Oxidative damage resistanceD1 turnover requirement30-40% reductionHigh light, drought
Enhanced repair mechanismRecovery from photoinhibition2-3× fasterVariable light conditions
Expression upregulationSteady-state D1 levels2-3× higherMultiple stresses
  • Implementation Approach

    • Utilize homologous recombination strategies similar to those demonstrated in Chlamydomonas reinhardtii

    • Develop chloroplast transformation protocols optimized for potato

    • Screen transformants using the restriction site modification strategy for efficient identification

This comprehensive engineering approach, informed by molecular insights from cyanobacterial psbA variants and plant stress responses, offers significant potential for developing potato cultivars with enhanced photosynthetic performance under challenging environmental conditions .

What are the molecular mechanisms of high temperature tolerance in engineered psbA variants, and how might these be applied to crop improvement?

The molecular mechanisms underlying high temperature tolerance in engineered psbA variants involve several structural and functional adaptations that can be strategically applied to crop improvement:

  • Structural Stabilization Mechanisms

    • Hydrogen bonding networks: Enhanced thermostability in certain psbA variants correlates with modified hydrogen bonding patterns around critical cofactors. In cyanobacteria, the Gln to Glu change at D1-130 strengthens hydrogen bonding with pheophytin, potentially contributing to thermal stability .

    • Protein-lipid interactions: Modifications at positions like D1-270 (S270A) alter interactions with membrane lipids such as sulfoquinovosyl-diacylglycerol, potentially enhancing membrane integrity at elevated temperatures .

    • Conformational rigidity: Strategic amino acid substitutions can increase thermostability by reducing protein flexibility in regions susceptible to thermal denaturation.

  • Functional Adaptations for High Temperature

    • Enhanced repair mechanisms: Accelerated D1 turnover through optimized degradation and insertion pathways compensates for increased photodamage at high temperatures.

    • Optimized electron transport: Modifications to the QB binding site can maintain efficient plastoquinone exchange at elevated temperatures.

    • ROS management: Engineered variants with improved electron transport reduce the production of reactive oxygen species at high temperatures.

  • Comparative Analysis of Thermotolerant Variants

ModificationMolecular MechanismThermal BenefitImplementation Strategy
D1-130 (Gln→Glu)Strengthened H-bond with pheophytinStabilized electron transferSite-directed mutagenesis
D1-270 (Ser→Ala)Modified lipid interactionEnhanced membrane stabilityTargeted replacement of exon 4
Multiple psbA gene isoformsStress-specific expressionResponsive adaptationGene addition/regulation
  • Application to Crop Improvement

    • Precision engineering approach: Target specific residues in crop psbA genes corresponding to those identified in thermotolerant variants.

    • Homologous recombination strategy: Apply transformation techniques demonstrated in Chlamydomonas to crops, using linear DNA fragments with homologous flanking regions .

    • Selection system: Utilize marker systems like spectinomycin resistance and screening methods like restriction site modification for efficient identification of transformants .

  • Thermotolerance Testing Protocol

    • Graduated temperature challenge: Expose transformants to temperature gradients (30-45°C).

    • Photosynthetic performance metrics: Measure oxygen evolution, chlorophyll fluorescence, and electron transport rates under heat stress.

    • Recovery assessment: Evaluate PSII repair efficiency following heat-induced photoinhibition.

This mechanistic understanding of thermotolerance in engineered psbA variants provides a rational basis for developing heat-resistant crop varieties through targeted chloroplast genome engineering .

What are the key challenges in achieving homoplasmy when introducing recombinant psbA variants into the Solanum tuberosum chloroplast genome?

Achieving homoplasmy (uniform genetic content across all chloroplast genome copies) presents several specific challenges when introducing recombinant psbA variants into the potato chloroplast genome:

  • Multiple Genome Copy Challenge

    • Potato chloroplasts contain numerous genome copies (up to 100 per chloroplast)

    • Initial transformation typically results in heteroplasmy (mixed wild-type and transformed genomes)

    • Strategy: Pre-treatment with 5-fluoro-2′-deoxyuridine (FUDR) to reduce chloroplast DNA copy number prior to transformation, as demonstrated in Chlamydomonas

    • Challenge metric: Typically requires 3-5 rounds of selection to achieve homoplasmy

  • Selection Pressure Optimization

    • Maintaining appropriate antibiotic pressure is critical but challenging

    • Too low: Fails to eliminate wild-type genomes

    • Too high: May inhibit plant regeneration

    • Strategy: Graduated selection approach with increasing spectinomycin concentrations

    • Challenge metric: 30-40% of initial transformants fail to achieve homoplasmy

  • Tissue-Specific Segregation Issues

    • Different tissues may show varying levels of transformed genomes

    • Meristematic tissues particularly challenging for complete conversion

    • Strategy: Extended tissue culture under selection before plant regeneration

    • Challenge metric: Up to 25% of plants show tissue-specific heteroplasmy even after selection

  • Recombination Efficiency Variables

    • Homologous sequence length significantly impacts recombination efficiency

    • Challenge: Balancing construct size with recombination efficiency

    • Strategy: Utilize flanking sequences >500 bp on each side of the target region

    • Optimization of homologous recombination-based methodology as demonstrated in other systems

  • Modified Screening Strategy for S. tuberosum

    • Adapt the restriction site modification approach from Chlamydomonas

    • Include diagnostic restriction site modifications alongside functional mutations

    • Develop PCR-based assays to quantify heteroplasmy levels

    • Strategy: Combine restriction fragment length polymorphism (RFLP) analysis with deep sequencing

This systematic approach to addressing homoplasmy challenges can significantly improve the efficiency of generating stable transformants with recombinant psbA variants in potato, facilitating downstream functional studies and potential crop improvement applications .

How might advances in structural biology inform the rational design of psbA variants with enhanced functionality?

Recent advances in structural biology provide unprecedented opportunities for rational design of psbA variants with enhanced functionality:

  • High-Resolution Structure Integration

    • Cryo-electron microscopy has revealed atomic-level details of PSII architecture

    • Crystal structures of PSII from cyanobacteria with different psbA variants provide critical comparative data

    • These structures enable precise mapping of:

      • Water molecule networks essential for proton transport

      • Binding positions of cofactors like pheophytin and plastoquinone

      • Protein-lipid interfaces that influence stability

    • Design application: Target specific residues that coordinate these elements with single-amino acid precision

  • Dynamic Structural Analysis

    • Molecular dynamics simulations reveal flexibility and conformational changes

    • Time-resolved crystallography captures intermediate states during electron transfer

    • These approaches identify:

      • Regions with excessive flexibility that might benefit from stabilization

      • Rate-limiting conformational changes that could be optimized

      • Water channels where flow might be enhanced or restricted

    • Design application: Modify residues that influence critical dynamic processes rather than just static interactions

  • Structure-Guided Mutation Matrix

Structural FeatureTarget ResiduesDesired ModificationExpected Functional Enhancement
Pheophytin binding pocketD1-130 regionStrengthen H-bondingIncreased redox potential stability
QB binding siteD1-270 and surroundingOptimize plastoquinone interactionEnhanced electron transfer efficiency
Channel for proton egressD1-P173 regionModify channel dimensionsImproved proton transport kinetics
Interface with cytochrome b6fSurface residuesEnhance protein-protein interactionFaster downstream electron transfer
  • Integrative Structural Biology Approach

    • Combine multiple data types:

      • X-ray crystallography for static high-resolution details

      • Cryo-EM for native state architecture

      • NMR for dynamic properties

      • Cross-linking mass spectrometry for interaction maps

    • Design application: Create comprehensive structural models that account for all aspects of D1 function

  • Machine Learning-Enhanced Design

    • Train neural networks on structure-function relationships

    • Predict functional outcomes of novel mutations

    • Identify non-obvious residue combinations that might have synergistic effects

    • Design application: Generate optimized D1 sequences tailored to specific environmental conditions

What potential off-target effects should researchers monitor when introducing recombinant psbA variants in Solanum tuberosum?

When introducing recombinant psbA variants in Solanum tuberosum, researchers should implement comprehensive monitoring for several categories of potential off-target effects:

  • Photosynthetic Network Disruption

    • Electron transport chain imbalances: Modified D1 properties may create bottlenecks or excessive electron flow in specific segments of the electron transport chain

    • Redox state perturbations: Altered D1 function can modify the redox state of the plastoquinone pool, affecting signaling

    • ATP/NADPH ratio shifts: Changes in electron flow can disrupt the critical ATP/NADPH balance required for carbon fixation

    • Monitoring approach: Measure electron transport rates at different segments of the photosynthetic apparatus using specific electron donors/acceptors and compare with transcriptome data patterns observed in related studies

  • Retrograde Signaling Alterations

    • Chloroplast-to-nucleus signaling may be modified due to altered ROS production, redox state, or metabolite levels

    • These changes can trigger unexpected nuclear gene expression adjustments

    • Monitoring approach: Conduct time-course transcriptome analysis similar to the temporal analysis (2h and 5h) used in chitosan treatment studies

  • Protein Complex Assembly Disruptions

ComplexPotential DisruptionMonitoring MethodReference Threshold
PSII assemblyAltered D1 incorporationBlue native PAGE<15% variation from WT
Supercomplex formationModified interaction with antenna proteinsSucrose gradient ultracentrifugationDistinct band pattern
D1 turnover cycleChanged degradation kineticsPulse-chase labelingTurnover rate within 30% of WT
  • Metabolic Ripple Effects

    • Carbon fixation efficiency may be affected indirectly

    • Metabolites involved in photorespiration may accumulate differently

    • Storage compound synthesis (starch, proteins) could be modified

    • Monitoring approach: Conduct untargeted metabolomics and compare changes to known patterns of photosynthetic mutants

  • Developmental and Physiological Impacts

    • Plant development may be affected through changed energy availability

    • Stress response thresholds could be modified

    • Reproductive development might show unexpected changes

    • Monitoring approach: Conduct comprehensive phenotyping across life stages and multiple environmental conditions

  • Design of Comprehensive Monitoring Protocol

    • Baseline measurements before stress application

    • Time-course analysis of physiological parameters

    • Comparative 'omics' approach (transcriptomics, proteomics, metabolomics)

    • Specific focus on genes identified in related studies, such as those encoding proteins for PSII, cytochrome b6f complex, PSI, and ATP synthase

This systematic monitoring framework ensures that potential off-target effects are detected early, allowing researchers to fully understand the broader impacts of psbA modifications and make informed decisions about their application in crop improvement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.