Recombinant Solea solea Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Solea solea Rhodopsin (rho) is a partial-length protein engineered for use in laboratory settings. It is produced via heterologous expression systems (e.g., baculovirus or E. coli) and purified to >85% homogeneity (SDS-PAGE) . The protein retains structural and functional motifs central to rhodopsin’s role as a G-protein-coupled receptor (GPCR) in phototransduction.

Production and Quality Control

The baculovirus-expressed recombinant protein undergoes rigorous purification and characterization:

Production Protocol

  1. Expression System: Baculovirus-infected insect cells (e.g., Spodoptera frugiperda) .

  2. Purification: Affinity chromatography or SDS-PAGE-based validation .

  3. Tagging: Tag type determined during manufacturing (e.g., His-tag for metal affinity purification) .

Disease Mechanism Research

  • Retinal Dystrophies: Mutations in RHO (e.g., P23H, T17M) cause autosomal dominant retinitis pigmentosa (ADRP). Recombinant Solea solea rhodopsin aids in studying misfolding, ER retention, and constitutive activation .

  • Therapeutic Development: Screens for pharmacological chaperones (e.g., YC-001) to rescue misfolded rhodopsin .

Comparative Analysis

FeatureSolea solea RhodopsinBovine Rhodopsin Microbial Rhodopsins
ChromophoreRequires retinal additionNative retinal bindingRetinal-dependent
FunctionPhototransduction (rod-like)Light-driven proton pumpProton pumping (e.g., BR)
Expression SystemBaculovirusNative retinaArchaeal cells

Comparative Insights with Other Rhodopsins

AspectSolea solea RhodopsinHuman Rhodopsin Bacteriorhodopsin
Expression SystemBaculovirusNative retinaHalobacterium salinarum
Therapeutic RelevanceLimitedHigh (ADRP, CSNB)Low
Structural ComplexityPartialFull-lengthFull-length

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Solea solea (Common sole)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMLNTTGIVRSPYEYPQYYLVNPAAYAALCAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAVERWMVVCKPISNFRFTENHAIMGLGFTWFAASACAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFVCHFLIPLIVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIAFLICWCPYAGVAWYIFSNQGSEFGPLFMTIPAFFAKSSSI YNPLIYIFMNKQFRHCMITTLCCGKNPFEEEEGSTTTSKTEASSASSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. While most marine fish species utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling cascade.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Solea solea rhodopsin and how does it compare to other species' rhodopsins?

Solea solea (common sole) rhodopsin is the primary visual pigment in rod photoreceptor cells of this flatfish species. Like other rhodopsins, it consists of the protein opsin bound to a chromophore (typically 11-cis-retinal), forming a light-sensitive G-protein coupled receptor that initiates the visual transduction cascade.

While specific comparative data on Solea solea rhodopsin is limited, research on rhodopsin variants in other species provides insights into its likely structure and function. Rhodopsin consists of seven transmembrane domains with intracellular and extracellular loops, containing critical residues for chromophore binding and G-protein interaction . The protein forms a Schiff base linkage between the chromophore and a conserved lysine residue, with stability maintained by critical disulfide bonds .

As a flatfish species that undergoes metamorphosis and adopts a benthic lifestyle, Solea solea likely possesses rhodopsin adaptations related to its specific visual environment, potentially including spectral tuning modifications.

Why is recombinant Solea solea rhodopsin valuable for research applications?

Recombinant Solea solea rhodopsin offers several advantages for research:

  • Serves as a model system for studying G-protein coupled receptors (GPCRs)

  • Enables investigations into visual adaptation in flatfish species

  • Provides insights into evolutionary adaptations to different light environments

  • Facilitates comparative studies across species with diverse visual ecologies

  • Allows for controlled mutagenesis studies to probe structure-function relationships

  • Supports research on metamorphosis-associated changes in visual systems

The transcriptome of Solea solea has been sequenced and characterized , providing the genetic foundation for recombinant expression of its visual proteins, including rhodopsin.

What developmental patterns of rhodopsin expression occur in Solea solea?

Solea solea undergoes dramatic metamorphosis during development, involving significant changes in its visual system. Microarray and RT-qPCR studies of larval transcriptomes reveal temporal regulation of genes involved in visual system development during early stages .

The expression of visual system genes, including rhodopsin-related pathways, shows distinctive patterns during pre-metamorphic, metamorphic, and post-metamorphic stages. Gene expression analysis indicates upregulation of visual system ontogenesis during early larval development, followed by tissue rearrangement during metamorphosis .

Notably, pathways related to retinol metabolism show significant regulation during development, with specific temporal windows of retinoic acid production . Key genes in this pathway include RALDH2 (Retinaldehyde dehydrogenase 2), CRABP (Cellular retinoic acid binding protein 1), and CRBP (Cellular retinol-binding protein) .

What expression systems are most effective for recombinant Solea solea rhodopsin?

The choice of expression system critically impacts the quality and functionality of recombinant rhodopsin. Based on successful approaches with other rhodopsins:

Expression SystemAdvantagesLimitationsBest Applications
Mammalian cell lines (HEK293, COS-7)Native-like post-translational modifications; Proper folding; Good for trafficking studiesHigher cost; Lower yieldFunctional studies; Trafficking analysis
Stable inducible cell linesConsistent expression; Controllable inductionTime-consuming to establishLong-term studies; Comparative mutant analysis
Insect cells (Sf9, Hi5)Higher yield than mammalian; Good foldingDifferent glycosylation patternStructural studies; Protein-protein interactions
Yeast (Pichia pastoris)Scalable; Lower costMay require optimization for membrane proteinsLarge-scale production
E. coliHighest yield; Lowest costRequires refolding; Lacks post-translational modificationsStructural studies after optimization

For studying rhodopsin function, mammalian or insect cell systems are generally preferred, as they provide appropriate folding environments and post-translational modifications . Stable inducible cell lines, similar to those used for human rhodopsin variants, allow for controlled expression and consistent protein production .

What are the critical factors for maintaining stability during purification?

Rhodopsin is notably sensitive to environmental conditions. Key considerations include:

  • Light exposure: All procedures should be performed under dim red light (>650nm) to prevent unwanted photoactivation

  • Temperature control: Rhodopsin mutants exhibit decreased thermal stability, suggesting wild-type proteins also require careful temperature management

  • Addition of stabilizers: 11-cis-retinal addition during purification can enhance stability, as demonstrated in pharmacological rescue experiments

  • Detergent selection: Critical for membrane protein solubilization while maintaining native-like environment

  • Buffer composition: pH, ionic strength, and glycerol concentration affect stability

  • Handling time: Minimize to reduce spontaneous activation or denaturation

Stability can be assessed through thermal stability assays and hydroxylamine sensitivity tests, which have successfully differentiated stability levels among rhodopsin variants .

What methods can verify proper folding and functionality of recombinant rhodopsin?

Multiple complementary approaches should be employed:

  • Spectroscopic analysis:

    • Characteristic absorption maximum (~500nm, depending on species)

    • Spectral shift upon photoactivation

    • Formation of spectrally distinct photointermediates

  • Biochemical assessments:

    • Glycosylation profile analysis

    • Thermal stability measurements

    • Hydroxylamine sensitivity

    • G-protein activation assays

  • Cellular assessments:

    • Cell surface expression levels

    • Trafficking patterns in expression systems

    • Response to pharmacological chaperones

  • Photobleaching behavior:

    • Ratio of metarhodopsin-I to metarhodopsin-II species

    • Photoproduct accumulation patterns

    • Regeneration capacity with chromophore

Studies on rhodopsin variants have demonstrated that misfolding occurs along a spectrum, with proteins exhibiting varying degrees of structural instability . This suggests the importance of multiple validation approaches when working with recombinant rhodopsins.

What spectroscopic methods provide the most valuable information about rhodopsin structure and function?

Spectroscopic techniques are fundamental for rhodopsin characterization:

TechniqueInformation ProvidedTechnical Considerations
UV-Visible spectroscopyAbsorption maximum; Photobleaching kinetics; Chromophore bindingRequires purified protein; Light sensitive
Circular dichroismSecondary structure content; Thermal stability profilesLower sensitivity; Requires higher concentrations
Fluorescence spectroscopyConformational changes; Ligand binding; Energy transferIntrinsic tryptophan fluorescence or added probes
FTIR spectroscopyDetailed structural information; Hydrogen bonding networksOften requires specialized equipment
Resonance RamanChromophore-protein interactions; Bond characteristicsSpecialized equipment; Technical expertise
Time-resolved spectroscopyPhotointermediate formation kinetics; Reaction pathwaysComplex data analysis; Specialized equipment

When analyzing rhodopsin variants, studies have shown that photobleaching behavior can reveal functional abnormalities, including altered ratios of metarhodopsin-I-like to metarhodopsin-II-like species and aberrant photoproduct accumulation .

How can mutagenesis studies enhance our understanding of Solea solea rhodopsin?

Mutagenesis approaches provide powerful insights into structure-function relationships:

  • Structure-guided targeting:

    • Residues in the chromophore binding pocket

    • Transmembrane domain interfaces

    • G-protein interaction sites

    • Disulfide bond positions

  • Mutation classification based on impact:

    • Group A: Minimal structural disruption, detectable on cell surface (e.g., T4K, G106W)

    • Group B: Intermediate stability, rescuable by pharmacological chaperones (e.g., N15S, T17M)

    • Group C: Severe folding problems, not rescuable (e.g., P23L, C110Y)

  • Effect analysis:

    • Thermal stability assessments

    • Hydroxylamine sensitivity measurements

    • Photobleaching behavior characterization

    • Cell surface expression quantification

Research on human rhodopsin has shown that mutations can affect both biosynthesis and photoactivity , suggesting comprehensive functional assessment is necessary for Solea solea rhodopsin mutants.

What molecular modeling approaches are most informative for rhodopsin structure prediction?

Computational approaches complement experimental studies:

  • Homology modeling:

    • Based on crystal structures of bovine or other available rhodopsin structures

    • Validation through energy minimization and Ramachandran plot analysis

  • Molecular dynamics simulations:

    • Behavior in membrane environments

    • Conformational flexibility assessment

    • Water molecule networks and hydrogen bonding patterns

  • Ligand docking:

    • Chromophore binding predictions

    • Comparison of binding energies (e.g., 11-cis-retinal: ΔG = –8.7 kcal/mol)

    • Virtual screening of potential ligands or chaperones

  • Mutation effect prediction:

    • Stability changes upon mutation

    • Spatial or charge clash analysis

    • Disruption of critical interactions

Docking studies with bovine rhodopsin have successfully predicted binding conformations for retinal isomers, confirming the reliability of such approaches for visual pigment research .

How can researchers optimize photochemical experiments with light-sensitive rhodopsin?

Working with light-sensitive proteins requires specialized protocols:

  • Light control:

    • Perform all procedures under dim red light (>650nm)

    • Use appropriate filters for specific photoactivation experiments

    • Consider light path length and intensity in spectroscopic measurements

  • Temperature management:

    • Maintain consistent temperatures during experiments

    • Design thermal stability assays with precise temperature control

    • Account for temperature effects on photochemical reaction rates

  • Time-resolved measurements:

    • Synchronize light activation and data collection

    • Consider flash photolysis for capturing fast transitions

    • Design appropriate time courses for different photointermediate states

  • Controls and baselines:

    • Establish proper dark-state baselines

    • Include appropriate controls for spontaneous activation

    • Account for sample-to-sample variation

Photobleaching experiments have revealed that mutant rhodopsins can display abnormal accumulation of photoproducts with prolonged illumination , highlighting the importance of controlled light exposure protocols.

What are the most common problems in recombinant rhodopsin research and how can they be addressed?

Researchers frequently encounter several challenges:

ChallengePotential CausesSolutions
Low expression levelsPoor codon optimization; Protein toxicity; Improper promoterOptimize codons; Use inducible systems; Try different promoters
MisfoldingMutation effects; Improper cellular environment; Detergent effectsAdd pharmacological chaperones; Optimize expression conditions; Screen detergents
Instability during purificationTemperature fluctuations; Proteolysis; Detergent effectsControl temperature; Add protease inhibitors; Optimize detergent
Poor chromophore bindingStructural distortion; Incorrect pH; Inadequate chromophoreOptimize pH; Increase chromophore concentration; Try chromophore analogs
Inconsistent functional assaysPartial activation; Variable protein quality; Assay conditionsStandardize protein preparation; Optimize assay conditions; Use multiple assay types

Research on rhodopsin variants shows that some mutants with severe folding problems (e.g., C110Y) are produced at low levels and do not yield functional rhodopsin , while others with mild instability can be rescued by pharmacological approaches .

How can researchers resolve contradictory findings in rhodopsin functional studies?

When faced with inconsistent results:

  • Experimental approach diversification:

    • Use multiple expression systems

    • Apply complementary biophysical techniques

    • Combine in vitro and cell-based assays

  • Condition standardization:

    • Control temperature, pH, ionic strength

    • Standardize detergent type and concentration

    • Establish consistent light activation protocols

  • Comprehensive mutation analysis:

    • Examine effects on biosynthesis AND photoactivity

    • Consider both trafficking and functional impacts

    • Evaluate structural context of mutations

  • Cross-validation:

    • Use multiple functional assays

    • Verify key findings with independent techniques

    • Consider independent laboratory replication

Studies on rhodopsin variants have demonstrated that the effects of mutations span a spectrum of severity and impact multiple aspects of protein biology , suggesting that comprehensive analysis approaches are essential for resolving apparently contradictory findings.

How might recombinant Solea solea rhodopsin contribute to understanding visual adaptation during flatfish metamorphosis?

Flatfish undergo dramatic metamorphosis involving eye migration and visual system adaptation. Recombinant rhodopsin studies could explore:

  • Developmental regulation:

    • Changes in rhodopsin expression during metamorphosis

    • Correlation with transcriptomic changes observed in larval stages

    • Relationship to thyroid hormone and growth hormone pathways that regulate metamorphosis

  • Visual environment adaptation:

    • Spectral tuning modifications during transition to benthic lifestyle

    • Changes in rhodopsin stability related to environmental shifts

    • Modifications in rhodopsin regeneration kinetics

  • Comparative analysis:

    • Pre- versus post-metamorphic rhodopsin properties

    • Differences from pelagic fish rhodopsins

    • Correlation with dietary and habitat changes during development

The transcriptomic landscape of pre-metamorphic Solea solea larvae shows distinctive patterns , suggesting molecular and cellular reorganization that likely impacts the visual system and rhodopsin function.

What role might pharmacological chaperones play in studying recombinant rhodopsin stability?

Pharmacological chaperones offer valuable research tools:

  • Stability assessment:

    • Relative rescue effects correlate with protein stability

    • Differential chaperone sensitivity indicates structural variations

    • Quantifiable metric for comparing mutant stability

  • Mechanism investigation:

    • Structure-activity relationships of chaperones

    • Binding site identification through competitive studies

    • Molecular dynamics simulations of chaperone-protein interactions

  • Applications in research:

    • Yield improvement for challenging variants

    • Structure stabilization for biophysical studies

    • Probe for identifying critical folding intermediates

Studies have shown that compounds like YC-001 and F5257-0462 improve glycosylation profiles of rhodopsin mutants and rescue misfolded variants from the endoplasmic reticulum to the plasma membrane , demonstrating their potential utility in recombinant rhodopsin research.

How can recombinant Solea solea rhodopsin research integrate with broader ecological and evolutionary studies?

Rhodopsin research can connect to broader biological questions:

  • Ecological adaptation:

    • Correlation between rhodopsin properties and Solea solea trophic ecology

    • Relationship between visual adaptation and prey detection in benthic environments

    • Visual protein evolution in response to habitat preferences

  • Comparative evolutionary studies:

    • Rhodopsin adaptations across flatfish species

    • Correlation with phylogenetic relationships

    • Identification of convergent evolutionary adaptations in visual proteins

  • Developmental biology integration:

    • Visual system changes during metamorphosis

    • Relationship to gene expression patterns during larval-to-juvenile transition

    • Connection between visual development and feeding behavior changes

Studies on Solea solea have shown it is an opportunistic species and generalist benthivore , suggesting its visual system, including rhodopsin, may have adapted to optimize prey detection in diverse benthic environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.