Recombinant Solibacter usitatus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Solibacter usitatus ATP synthase subunit b (atpF) is a component of the ATP synthase complex found in the bacterium Solibacter usitatus . ATP synthase, also known as F1Fo-ATPase, is an essential enzyme that produces adenosine triphosphate (ATP), the primary energy currency of cells, through oxidative phosphorylation . Subunit b (atpF) is a crucial part of the Fo sector of ATP synthase, which is embedded in the cell membrane and facilitates proton translocation .

Characteristics

CharacteristicDescription
Alternative NamesATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
SourceCan be produced in E. coli, Yeast, Baculovirus or Mammalian cells
Purity>85% (SDS-PAGE) when produced in E. coli
Tag InfoTag type is determined during the manufacturing process
Protein LengthPartial
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; adding 5-50% glycerol is recommended for long-term storage
Shelf LifeLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
UniProt No.Q02BU5

Structure and Function

The ATP synthase complex consists of two main portions: F1 and Fo . The F1 sector is located in the cytoplasm and is responsible for ATP synthesis, while the Fo sector is embedded in the membrane and facilitates the movement of protons across the membrane, using the electrochemical gradient to drive ATP synthesis .

Subunit b (atpF) is a key component of the Fo sector, specifically interacting with subunit a . Research indicates that the N-terminal α-helix of subunit b interacts with transmembrane α-helices of subunit a, which is vital for the assembly and activity of the ATP synthase complex . Mutations in this region can be detrimental to the enzyme's function, underscoring the importance of subunit b in maintaining the structural integrity and functional efficiency of ATP synthase .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; Acid_0461; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Solibacter usitatus (strain Ellin6076)
Target Names
atpF
Target Protein Sequence
MRRLAVYLAIAVGLFAQAPKEGARESLAEKADEAGNKAHAAEEEGSMDIWKWANFLILAG GLGYLVGKNAGPFFAARSAGIRKDMENSLAQQKDAEARAADVDRRLANMEADIAALRGEG ERAARAEAERMEQHTAAEIAKIQQHSEQEIASAGKAARMDLKRYAAELAVELAEQKVRAR MTPETQDALVQGFVRNLK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b (atpF) in Solibacter usitatus?

ATP synthase subunit b (atpF) in Solibacter usitatus functions as part of the peripheral stalk (stator) of the F₁F₀-ATP synthase complex. This subunit plays a critical structural role in connecting the membrane-embedded F₀ sector with the catalytic F₁ sector of the ATP synthase. Specifically, subunit b forms a right-handed coiled-coil dimer that extends from the membrane to interact with subunits α and δ in the F₁ sector. This structural connection is essential for preventing the rotation of these subunits during catalysis, thereby allowing the γ subunit to rotate within the α₃β₃ hexamer to drive ATP synthesis. Unlike ATP synthase in some other bacterial species, the Solibacter usitatus enzyme maintains the fundamental structure and function observed in most bacterial F-type ATP synthases, making it valuable for comparative studies across bacterial phyla .

What are the basic expression systems suitable for producing recombinant Solibacter usitatus ATP synthase subunit b?

Several expression systems have proven effective for producing recombinant ATP synthase subunits, each with distinct advantages depending on research objectives. E. coli remains the most commonly utilized expression system due to its well-established protocols, rapid growth, and high protein yields. For Solibacter usitatus atpF expression, BL21(DE3) or Rosetta(DE3) strains are particularly suitable when using pET-series vectors with IPTG-inducible promoters. Temperature optimization is critical, with expression typically more successful at lower temperatures (16-25°C) to allow proper folding of the protein. For functional studies requiring assembled ATP synthase complexes, alternative expression systems such as Bacillus subtilis might prove advantageous as they more closely resemble the native environment of Solibacter usitatus. When pursuing structural studies, inclusion of affinity tags (particularly His₆-tags) facilitates purification while affording the option of tag removal via engineered protease cleavage sites. The choice between cytoplasmic expression versus membrane-directed expression depends on whether isolated subunit b or membrane-integrated protein is desired for subsequent experiments .

How can researchers differentiate between ATP synthase inhibitor effects on Solibacter usitatus atpF versus other subunits of the complex?

Differentiating inhibitor effects specifically on the atpF subunit versus other ATP synthase components requires multifaceted approaches combining biochemical, genetic, and structural methods. First, researchers should employ site-directed mutagenesis targeting conserved residues in atpF to identify regions critical for inhibitor binding. These mutants can then be assessed in ATP synthesis/hydrolysis assays to determine functional consequences. Complementary approaches include photo-affinity labeling using modified inhibitors with UV-activatable crosslinkers to covalently bind target proteins, followed by mass spectrometry to identify binding sites. For more definitive evidence, researchers can perform subunit-specific competition assays using purified recombinant atpF to determine if it sequesters inhibitors and prevents their effect on the holoenzyme. Unlike inhibitors such as tomatidine that specifically target the c subunit (atpE) of ATP synthase, compounds affecting atpF would typically disrupt the structural integrity of the peripheral stalk rather than directly affecting the catalytic or proton-conducting functions. This distinction can be experimentally verified through comparative analysis with known subunit-specific inhibitors, such as those targeting atpE .

What are the implications of recent structural studies on bacterial ATP synthase stalk subunits for understanding Solibacter usitatus atpF dynamics?

Recent structural studies of bacterial ATP synthase stalk subunits have revealed critical insights potentially applicable to Solibacter usitatus atpF. High-resolution cryo-electron microscopy and X-ray crystallography studies of bacterial ATP synthases have demonstrated that the b subunit dimer exhibits both rigidity and elasticity properties essential for enzyme function. This structural flexibility allows the peripheral stalk to act as a molecular spring that accommodates conformational changes during catalytic cycles while maintaining structural integrity. For Solibacter usitatus specifically, these findings suggest that its atpF likely contains regions of differing flexibility that optimize energy transfer between the F₀ and F₁ sectors. The right-handed coiled-coil structure of subunit b dimers, contrary to the more common left-handed coiled-coils in proteins, creates unique torsional properties that may be essential for resisting the rotational forces generated during ATP synthesis. Understanding these structural dynamics provides potential targets for developing species-specific inhibitors that could disrupt the mechanical coupling between membrane proton translocation and ATP synthesis without affecting human mitochondrial ATP synthases .

What molecular mechanisms might explain differential inhibitor sensitivity between Solibacter usitatus ATP synthase and ATP synthases from other bacterial species?

Differential inhibitor sensitivity between ATP synthases from various bacterial species primarily derives from subtle structural variations in inhibitor binding sites. These variations result from evolutionary divergence and adaptive pressures specific to each bacterial niche. For Solibacter usitatus, its adaptation to soil environments may have shaped unique structural features in its ATP synthase subunits, including atpF. Several molecular mechanisms potentially responsible for differential inhibitor sensitivity include: (1) amino acid substitutions at critical interface regions between subunits, particularly where inhibitors like tomatidine bind; (2) altered hydrophobicity profiles affecting inhibitor access to binding pockets; (3) species-specific post-translational modifications; and (4) variations in membrane lipid composition affecting local protein environment. Experimental evidence from other ATP synthase inhibitors demonstrates that even single amino acid substitutions can dramatically alter inhibitor sensitivity. For instance, the remarkable selectivity index (>10⁵-fold) of FC04-100 (a tomatidine derivative) between bacterial and mitochondrial ATP synthases illustrates how subtle structural differences can be exploited for selective targeting. These principles likely extend to potential inhibitors specifically targeting the atpF subunit in Solibacter usitatus compared to homologous subunits in other bacteria .

What are the optimal conditions for purifying functional recombinant Solibacter usitatus ATP synthase subunit b?

Purification of functional recombinant Solibacter usitatus ATP synthase subunit b requires careful optimization of several parameters to maintain protein integrity and native conformation. The purification protocol should begin with cell lysis under gentle conditions, typically using buffer systems containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol to stabilize the protein. If the recombinant protein includes a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides effective initial purification with imidazole gradients (20-250 mM) for elution. For membrane-associated forms of atpF, detergent selection is critical; mild non-ionic detergents like n-dodecyl β-D-maltoside (DDM) at 0.05-0.1% often provide the best balance between protein solubilization and structural preservation. Following IMAC, size-exclusion chromatography using Superdex 200 columns further improves purity while allowing assessment of oligomeric state. Throughout purification, maintaining sample temperature at 4°C and including protease inhibitors (PMSF, leupeptin, and pepstatin A) prevents degradation. Protein functionality can be verified through circular dichroism to confirm secondary structure integrity and binding assays with known interaction partners from the ATP synthase complex. Final preparations should achieve >95% purity as assessed by SDS-PAGE and maintain stability for at least 1-2 weeks when stored at -80°C in buffer containing 10% glycerol .

What experimental approaches can effectively assess the interaction between Solibacter usitatus atpF and potential inhibitor compounds?

Multiple complementary experimental approaches can effectively characterize interactions between Solibacter usitatus atpF and potential inhibitors. Surface plasmon resonance (SPR) offers real-time, label-free detection of binding interactions, providing both kinetic and affinity data. For SPR studies, purified recombinant atpF should be immobilized on CM5 sensor chips with potential inhibitors flowed at concentrations ranging from 0.1-100 μM. Isothermal titration calorimetry (ITC) provides thermodynamic parameters of binding, revealing enthalpy and entropy contributions that inform on the nature of the molecular interactions. Microscale thermophoresis (MST) offers an alternative approach requiring minimal protein quantities while providing affinity data in near-native conditions. Structural characterization of inhibitor binding can be achieved through X-ray crystallography of co-crystallized atpF-inhibitor complexes or through NMR spectroscopy for mapping binding interfaces. Functional consequences of inhibitor binding should be assessed in reconstituted systems measuring ATP synthesis/hydrolysis activities. Particularly informative is the inverted membrane vesicle ATP synthesis assay, which allows correlation between inhibitor potency and ATP synthase inhibition, as demonstrated with tomatidine derivatives. Researchers should employ concentration ranges spanning at least three orders of magnitude around the expected IC₅₀ values to generate reliable dose-response curves characterizing inhibitor potency .

How can researchers effectively design mutagenesis studies to identify critical functional regions of Solibacter usitatus atpF?

Effective mutagenesis studies for identifying critical functional regions of Solibacter usitatus atpF require strategic planning based on evolutionary conservation, structural predictions, and systematic variation. The first essential step involves comprehensive sequence alignment of atpF across diverse bacterial species to identify highly conserved residues, which typically indicate functional importance. Structural modeling using homology-based approaches with solved structures of bacterial b subunits provides a framework for selecting mutation sites based on predicted structural features. Researchers should prioritize residues at interfaces with other ATP synthase subunits, particularly those interacting with a, δ, and α subunits. Systematic mutagenesis approaches should include: (1) alanine-scanning mutagenesis of conserved charged or polar residues, particularly those in predicted interaction interfaces; (2) conservative substitutions maintaining charge or polarity to distinguish between structural versus specific chemical requirements; and (3) introduction of proline residues in predicted α-helical regions to test the importance of secondary structure integrity. Each mutant should undergo functional characterization through complementation studies in atpF-deficient strains, measuring growth rates, ATP synthesis capabilities, and membrane potential. For detailed mechanistic insights, reconstitution of mutant proteins into liposomes allows direct measurement of proton-pumping efficiency coupled to ATP synthesis. The pattern of functional defects across different mutations reveals the relative importance of specific residues and regions for atpF function .

What potential exists for developing selective inhibitors targeting Solibacter usitatus ATP synthase versus human mitochondrial ATP synthase?

Developing selective inhibitors that target bacterial ATP synthases while sparing human mitochondrial ATP synthases represents a promising avenue for new antimicrobial development, with lessons applicable to targeting Solibacter usitatus ATP synthase. The remarkable selectivity demonstrated by compounds like FC04-100, a tomatidine derivative with a >10⁵-fold selectivity index between bacterial and mitochondrial ATP synthases, illustrates the feasibility of this approach. This selectivity stems from structural differences between bacterial and mitochondrial ATP synthases, including variations in the peripheral stalk composition. While bacterial ATP synthases typically contain a homodimer of b subunits, mitochondrial ATP synthases contain a heterodimer of b and d subunits along with other auxiliary proteins. These structural differences create unique binding pockets and interaction surfaces that can be exploited for selective targeting. For Solibacter usitatus specifically, its environmental niche and phylogenetic distance from human-associated bacteria may have driven further evolutionary divergence in its ATP synthase structure. Rational drug design approaches targeting these unique features, particularly in the interfaces between atpF and other subunits, could yield highly selective inhibitors. Computer-aided drug design using homology models of Solibacter usitatus atpF compared against human mitochondrial equivalents can identify potential binding pockets unique to the bacterial protein, guiding the development of selective compounds with minimal off-target effects on human cells .

How might research on Solibacter usitatus ATP synthase contribute to understanding bacterial bioenergetics in soil microbiome communities?

Research on Solibacter usitatus ATP synthase provides valuable insights into bacterial bioenergetics within complex soil microbiome communities, where energy acquisition and utilization represent critical adaptive strategies. Solibacter usitatus, as a member of the Acidobacteria phylum that is abundant in soil environments, has likely evolved specialized bioenergetic mechanisms adapted to the heterogeneous and frequently nutrient-limited soil conditions. Studying its ATP synthase can reveal how soil bacteria optimize energy conservation under fluctuating environmental conditions, including periodic nutrient limitation, pH variations, and oxygen gradients. The functional characteristics of Solibacter ATP synthase, including its efficiency, regulatory mechanisms, and response to environmental stressors, may elucidate how these bacteria persist in competitive soil ecosystems. Particularly relevant is the observation in other bacterial systems that nutrient restriction and lower energy production can induce modifications in membrane composition and cell surface properties. In Solibacter, similar adaptations might influence interactions with other microbiome members, affecting community structure and function. Additionally, understanding the evolutionary relationship between Solibacter ATP synthase and those of other soil bacteria could provide insights into horizontal gene transfer events and co-evolutionary processes within soil microbiomes. This knowledge extends beyond basic science, potentially informing agricultural practices aimed at promoting beneficial soil microbiome functions, including nutrient cycling and plant growth promotion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.