Recombinant Sonchus yellow net virus Spike glycoprotein (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
G; Spike glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-632
Protein Length
Full Length of Mature Protein
Species
Sonchus yellow net virus (SYNV)
Target Names
G
Target Protein Sequence
SWSLLGYQDDFSSKRSGALASNPTYNLPQDKGYGRDMYQPYYICEPDNDGSALTLPSWHY SCKESCMGNHLKRVVNITGARWNYVGISIPVFKIVTNEVCYTSHENVWGYCSQYQISRPV ATQKSDVSCITSSMWDNDKSPIGSLYNIVNSNEAECDYFSDITDCNRDYQIFKREGKLIK RSDDSPLELSIVTDGIRTDPASEYLSLDDVSWFWKLPNNDMSPPCGWEKTQKLSCSYTDT TDVIKCNSIGYTYNIQGISKKSTCAGNIYDTDGPFPFFYDAEEALMSTDDACGKAKQGKP DADIAFIEGVNRAFEDLELTYCSATCDLFARQGTPNEDHVLDTPIGTWRYVMRDNLDPAL VPCLPTSNWTISDPTTICHGKDHILVVDTATGHSGSWDTKKDYIITGEVCNTNNDEMGDD YDGMRDKILRGETIEIKFWTGDIIRMAPPYDNPEWIKGSVLFRQNPGWFSSVELNKDMIH TRDNITDLLTVMVQNATAEVMYKRLDPKTMKHILFAEIVDGVGNVSGKISGFLTGLFGGF TKAVIIVASLAICYIVLSVLWKVRLVASIFNSAKKKRVRISDILDEEPHRIQQSRPTLSR KKKTRESIQMLLNDI
Uniprot No.

Target Background

Function

This protein constitutes the surface spikes of the virion. It mediates both viral attachment to susceptible host cells and subsequent cellular uptake. The interaction between the virion's internal components and the cytoplasmic-facing glycoprotein portion of the plasma membrane likely directs viral envelopment and budding.

Database Links

KEGG: vg:1489881

Protein Families
Nucleorhabdovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the Sonchus yellow net virus Spike glycoprotein?

The Spike glycoprotein (G) of Sonchus yellow net virus is a critical structural component that forms spikes on the virion surface. This protein is responsible for binding the virus to susceptible host cells and inducing cellular uptake. The interaction between internal virion components and the cytoplasmic-facing portion of the glycoprotein likely directs envelopment and virus budding processes . As a plant rhabdovirus component, the G protein plays an essential role in cell-to-cell movement and systemic infection establishment.

What is the molecular composition of SYNV Spike glycoprotein?

The glycoprotein (G) gene of SYNV is 2045 nucleotides long, with its mRNA open reading frame (ORF) containing 1896 nucleotides that encode a protein of 632 amino acids . The predicted molecular weight of the unmodified G protein is 70,215 Da, which is notably less than the 77,000 Da estimated for the fully glycosylated G protein isolated from virus particles . This difference highlights the significant contribution of post-translational modifications to the final protein structure. The protein contains a 34-nucleotide untranslated 5' leader sequence and a 115-nucleotide untranslated 3' end flanking the ORF on the mRNA .

How can researchers verify the identity of cloned SYNV G protein?

Researchers can verify the identity of cloned SYNV G protein through immunoblot analysis using antibodies specifically raised against purified glycoprotein from virus particles. In published studies, these antibodies successfully reacted with fusion proteins produced in Escherichia coli, confirming that the cloned ORF indeed encodes the authentic G protein . Additional verification methods include mass spectrometry analysis, functional binding assays, and sequence confirmation through comparison with the reference sequence (e.g., NP_042285.1).

What expression systems are optimal for producing recombinant SYNV G protein?

While E. coli has been successfully employed for SYNV G protein expression , researchers should consider that different expression systems offer various advantages depending on research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, antibody production
HEK293Native-like glycosylation, proper foldingHigher cost, longer production timeFunctional studies, binding assays
Insect cellsModerate glycosylation, high yieldDifferent glycosylation patterns than plant cellsIntermediate between bacterial and mammalian systems
Plant-basedNative host-like modificationsVariable yields, longer development timeMost authentic form for plant virus studies

For applications requiring functional activity, expression systems that support proper post-translational modifications are preferable since glycosylation significantly impacts the protein's structure and function .

What is the recommended purification strategy for recombinant SYNV G protein?

Based on commercial production protocols, recombinant SYNV G protein (amino acids 18-632) can be efficiently expressed with a His-tag for affinity purification . The biological activity can be determined through functional ELISA binding assays. For tag-free protein, alternative chromatography methods may be employed. Purification typically achieves >90% purity as determined by SDS-PAGE . Researchers should implement a multi-step purification strategy that may include:

  • Initial capture through affinity chromatography (His-tag or immunoaffinity)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

  • Quality control through SDS-PAGE and Western blotting

What functional domains characterize the SYNV G protein?

The SYNV G protein contains several key functional domains that contribute to its biological activities:

  • A signal sequence for targeting to the secretory pathway

  • A transmembrane anchor domain for membrane integration

  • Multiple glycosylation signals for post-translational modification

  • A putative nuclear targeting site near the carboxy terminus

This last feature is particularly noteworthy as it may be involved in the protein's transit to the nuclear membrane prior to morphogenesis, which is a distinctive feature of plant rhabdoviruses compared to their animal counterparts .

What approaches have improved recombinant SYNV recovery efficiency?

Recent advances have significantly enhanced recombinant SYNV recovery efficiency through a negative-sense genomic RNA-based approach. This method increased rescue efficiency by two orders of magnitude compared to conventional antigenomic RNA approaches . The system relies on suppression of double-stranded RNA-induced antiviral responses through co-expression of plant viruses-encoded RNA silencing suppressors or animal viruses-encoded double-stranded RNA antagonists .

This methodological breakthrough enabled the recovery of a highly attenuated SYNV mutant with a deletion in the matrix protein gene that previously could not be rescued via the antigenomic RNA approach .

How do comparative rescue efficiencies differ between genomic and antigenomic approaches?

ApproachInfection Foci (per field)Systemic Infection RateTime to Disease Onset
pSYNV-GFP(+) (agRNA)4.36.7%22 dpi
pSYNV-GFP(-) (gRNA) undiluted>100100%15 dpi
pSYNV-GFP(-) (gRNA) 50-fold diluted32.0Not specifiedNot specified
pSYNV-GFP(-) (gRNA) 100-fold diluted18.38.8%Not specified
pSYNV-GFP(-) (gRNA) 200-fold diluted5.32.2%Not specified

As evidenced by this data, the genomic RNA-based approach (gRNA) demonstrates significantly superior rescue efficiency, with even diluted preparations often outperforming the undiluted antigenomic approach .

What role does the SYNV G protein play in virus-host interactions?

The SYNV G protein serves as the primary determinant of host cell recognition and entry. It forms spikes on the virion surface that are responsible for binding to susceptible host cells and inducing viral uptake . The interaction between the internal components of the virion and the portion of the glycoprotein exposed on the cytoplasmic face of the plasma membrane likely directs envelopment and virus budding processes .

For researchers studying virus-host interactions, it is essential to examine how specific domains within the G protein contribute to host specificity and infection efficiency. Mutational analysis of the G protein can provide insights into which regions are critical for host cell recognition versus those involved in membrane fusion and viral entry.

How can reverse genetics approaches be applied to study SYNV G protein function?

The improved recovery system for recombinant SYNV has opened new avenues for reverse genetics studies of the G protein. Researchers can now engineer specific mutations or deletions in the G protein gene to assess their impact on virus assembly, morphogenesis, and infectivity . This approach has already provided insights into SYNV virion assembly through analysis of matrix protein deletion mutants.

For effective reverse genetics studies of the G protein, researchers should:

  • Design mutations based on the known functional domains

  • Utilize the negative-sense genomic RNA-based approach for efficient virus recovery

  • Co-express RNA silencing suppressors to enhance recovery

  • Employ fluorescent protein reporters (e.g., GFP) to track infection progression

  • Analyze both local infection foci and systemic spread to comprehensively assess G protein function

What are common challenges in working with recombinant SYNV G protein?

Researchers commonly encounter several challenges when working with recombinant SYNV G protein:

  • Ensuring proper folding and post-translational modifications

  • Maintaining protein stability during purification and storage

  • Verifying functional activity through appropriate binding assays

  • Addressing the differential behavior between E. coli-expressed and native viral G protein

  • Correctly interpreting molecular weight differences between predicted values (70,215 Da) and observed glycosylated forms (77,000 Da)

How should researchers interpret discrepancies between predicted and observed molecular weights?

The observed difference between the predicted molecular weight (70,215 Da) and the estimated weight of glycosylated G protein from virus particles (77,000 Da) is attributable to glycosylation . Researchers should consider this discrepancy when analyzing protein expression and purification results. Western blot analysis may show bands at different molecular weights depending on the expression system used and the degree of glycosylation. When expressing the protein in E. coli, the observed molecular weight will likely be closer to the predicted unmodified value due to the lack of glycosylation machinery in bacterial cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.