Recombinant Sorangium cellulosum ATP-dependent zinc metalloprotease FtsH 3 (ftsH3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sorangium cellulosum ATP-dependent Zinc Metalloprotease FtsH 3 (FtsH3)

Recombinant Sorangium cellulosum ATP-dependent zinc metalloprotease FtsH 3 (FtsH3) is a protein expressed in E. coli and fused to an N-terminal His tag . It functions as an ATP-dependent zinc metalloprotease . Metalloproteases are enzymes that depend on metal ions, such as zinc, for their activity, and FtsH3 contains a conserved HExxH motif, which is characteristic of metalloproteases . This motif is involved in metal binding and catalysis .

AttributeDescription
SourceE. coli
SpeciesSorangium cellulosum
TagHis tag (N-terminal)
Protein LengthFull Length (1-602 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage at -20℃/-80℃
Gene NameftsH3
SynonymsftsH3; sce2762; ATP-dependent zinc metalloprotease FtsH 3
UniProt IDA9GAW6
Amino Acid SequenceMNSWFLQVSKRLGPAGRRLWLLGFMGVVLAVTLGLALRAARESATQRTATYTELLQIAQAGQATAVEVSGDRFLVRQAGGAVVTAVVDEPTLRQELVSRFAGAGASVDFASREDPSRAASAVLPVVVLAAVGFALFTVSRRRSPKVFSDVKAGAARAAVRFADVAGMHEVKQELAETVEFLKSPDRFARLGGRPPRGVLLTGEPGTGKTLLARAVACEAGVRFLSASGSSFQEMFVGVGASRVRALFAEARKSAPCIVFIDEIDAVGRARAKGHGDSASAEHDQTLNQLLVEMDGFDHETGIVVIASTNRADMLDPALLRPGRFDRKVTVPLPDVRGREEILNVHAGPIPLQGEVDLSYIARGTPGFSGADLANLLNEAAILAAREGADAVDPTHIDRARDRVLMGLERKGVLVDEDERYATAVHEAGHVAVGLLAPSCDPVHKVSILPRGRALGVTQALPEKDRLMYRKEYLEDQICMLMGGRAAEMVVLGTMTAGASDDIQRASTIAWKMVAELGMSHLGPICVGDGHPSRSPALLDRVDETARALTEAQLSRAIEIVRSRRGEIEALVKALLEKETLGMDEIQACFPADRRPRPEDQAA

Function and Mechanism

FtsH3 is an ATP-dependent zinc metalloprotease, suggesting it utilizes the energy from ATP hydrolysis to perform its proteolytic function . Zinc metalloproteases use zinc ions to facilitate the hydrolysis of peptide bonds in target proteins . The general mechanism involves the zinc ion coordinating with the carbonyl oxygen of the scissile peptide bond, thereby polarizing it and making it more susceptible to nucleophilic attack . A water molecule, activated by a glutamate residue, then acts as the nucleophile to cleave the peptide bond .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsH3; sce2762; ATP-dependent zinc metalloprotease FtsH 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
ftsH3
Target Protein Sequence
MNSWFLQVSKRLGPAGRRLWLLGFMGVVLAVTLGLALRAARESATQRTATYTELLQIAQA GQATAVEVSGDRFLVRQAGGAVVTAVVDEPTLRQELVSRFAGAGASVDFASREDPSRAAS AVLPVVVLAAVGFALFTVSRRRSPKVFSDVKAGAARAAVRFADVAGMHEVKQELAETVEF LKSPDRFARLGGRPPRGVLLTGEPGTGKTLLARAVACEAGVRFLSASGSSFQEMFVGVGA SRVRALFAEARKSAPCIVFIDEIDAVGRARAKGHGDSASAEHDQTLNQLLVEMDGFDHET GIVVIASTNRADMLDPALLRPGRFDRKVTVPLPDVRGREEILNVHAGPIPLQGEVDLSYI ARGTPGFSGADLANLLNEAAILAAREGADAVDPTHIDRARDRVLMGLERKGVLVDEDERY ATAVHEAGHVAVGLLAPSCDPVHKVSILPRGRALGVTQALPEKDRLMYRKEYLEDQICML MGGRAAEMVVLGTMTAGASDDIQRASTIAWKMVAELGMSHLGPICVGDGHPSRSPALLDR VDETARALTEAQLSRAIEIVRSRRGEIEALVKALLEKETLGMDEIQACFPADRRPRPEDQ AA
Uniprot No.

Target Background

Function

Recombinant Sorangium cellulosum ATP-dependent zinc metalloprotease FtsH3 (ftsH3) functions as a processive, ATP-dependent zinc metallopeptidase, acting on both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.

Database Links

KEGG: scl:sce2762

STRING: 448385.sce2762

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is the molecular architecture of Sorangium cellulosum FtsH3?

Sorangium cellulosum FtsH3, like other FtsH family members, functions as a hexameric complex with two distinct ring structures. The molecular architecture consists of a protease domain that forms a flat hexagonal ring with an all-helical fold, covered by a toroid formed by the AAA+ (ATPases Associated with diverse cellular Activities) domains . The protease domain contains an active site that classifies FtsH3 as an Asp-zincin, with three zinc-coordinating ligands including an aspartic acid residue . The full complex incorporates membrane-spanning regions that anchor the protein to cellular membranes, though these are often removed in recombinant constructs to facilitate crystallization and enzymatic studies.

What distinguishes the catalytic mechanism of FtsH3 from other metalloproteases?

FtsH3 is classified as an Asp-zincin based on its active site configuration, which differs from earlier classifications. The protease uses an aspartic acid as the third zinc ligand in its active site , distinguishing it from other metalloprotease families. As an ATP-dependent protease, FtsH3 couples ATP hydrolysis to protein unfolding and translocation, with the substrate entering through a central pore before reaching the proteolytic chamber. Notably, compared to other AAA+ proteases, FtsH homologs exhibit relatively weak protein unfolding activity as measured by their efficiency in converting ATP hydrolysis to protein degradation . This suggests that FtsH3 may preferentially recognize substrates that are already partially unfolded or disassembled from their native complexes.

How does the ATPase domain contribute to FtsH3 function?

The ATPase function of FtsH3 plays a critical role in substrate recognition and processing that appears to be independent of its proteolytic activity. Research on plant homologs demonstrates that mutations in the ATPase domain (such as P415L in Arabidopsis FTSH3) can significantly alter protein function without disrupting proteolytic capacity . The ATPase domain is primarily responsible for:

  • Substrate recognition and binding

  • Energy-dependent protein unfolding

  • Translocation of substrates into the proteolytic chamber

What substrates does FtsH3 typically process in bacterial systems?

While the specific substrates of Sorangium cellulosum FtsH3 have not been comprehensively cataloged, FtsH proteases generally target:

  • Damaged or misfolded membrane proteins as part of quality control mechanisms

  • Regulatory proteins involved in stress responses

  • Orphaned subunits of protein complexes

In bacterial systems, FtsH has been shown to degrade soluble signaling factors like σ32 and λ-CII . By extrapolation from studies in other organisms, S. cellulosum FtsH3 likely participates in membrane protein quality control and the regulation of specific cellular pathways through targeted proteolysis.

How can researchers distinguish between the ATPase and proteolytic functions in experimental settings?

Distinguishing between ATPase and proteolytic activities requires specific experimental approaches:

FunctionExperimental ApproachReadoutAdvantages
ATPase activityMalachite green phosphate assayColorimetric detection of released phosphateHigh sensitivity, quantitative
ATPase activityCoupled enzyme assay (pyruvate kinase/lactate dehydrogenase)NADH oxidation measured spectrophotometricallyReal-time monitoring
Proteolytic activityFluorogenic peptide substratesFluorescence increase upon cleavageHigh sensitivity, real-time
Proteolytic activitySDS-PAGE analysis of substrate degradationVisualization of substrate disappearanceAllows analysis of specific substrates

For functional separation, researchers can generate point mutations in the proteolytic domain (such as FTSH3 TRAP constructs) that eliminate proteolytic activity while maintaining ATPase function . Complementation experiments in vivo can then reveal which activities are essential for specific cellular functions. For example, research on Arabidopsis FTSH3 showed that proteolytically inactive forms could still complement certain defects when the ATPase domain remained functional .

What protein-protein interaction methods are most effective for studying FtsH3 complexes?

Based on successful approaches with FtsH homologs, several complementary methods can effectively study FtsH3 interactions:

  • Co-immunoprecipitation (Co-IP): Particularly effective when combined with epitope tagging (such as FLAG-tags). This approach successfully demonstrated interactions between Arabidopsis FTSH3 and Complex I subunits .

  • Yeast-2-hybrid (Y2H) assays: Useful for confirming direct interactions and mapping interaction domains. Y2H successfully verified the direct interaction between FTSH3 and the PSST subunit of Complex I and identified mutations that disrupt this interaction .

  • Bimolecular Fluorescence Complementation (BiFC): Enables visualization of protein interactions in living cells. This method can verify interactions in native membrane environments .

  • Cross-linking mass spectrometry (XL-MS): Allows identification of interaction interfaces at amino acid resolution, particularly valuable for large complexes.

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST): Provides quantitative binding kinetics and affinities for purified components.

When studying membrane-bound proteins like FtsH3, careful selection of detergents and solubilization conditions is critical for maintaining native interactions.

What structural and functional features distinguish bacterial FtsH3 from its eukaryotic homologs?

Bacterial FtsH proteases and their eukaryotic counterparts share core structural elements but exhibit important differences:

FeatureBacterial FtsHEukaryotic FtsH Homologs
Cellular locationPlasma membraneMitochondrial inner membrane or chloroplast thylakoid membrane
Complex compositionTypically homohexamericOften heteromeric (e.g., i-AAA and m-AAA complexes)
Membrane orientationSingle orientationDifferent orientations: i-AAA (IMS-facing) and m-AAA (matrix-facing)
Regulatory mechanismsOften linked to stress responsesLinked to organelle quality control
Disease relevanceN/AMutations cause neurodegenerative diseases like hereditary spastic paraplegia and spinocerebellar ataxia

Eukaryotic systems have evolved specialized FtsH complexes with distinct orientations and functions. Human mitochondria contain two types of m-AAA proteases: the AFG3L2 homocomplex and the AFG3L2/SPG7 heterocomplex . These differences reflect the increased complexity of eukaryotic organellar quality control systems.

How does the symmetry of the FtsH3 complex relate to its mechanism of action?

FtsH exhibits an intriguing breakdown of expected hexagonal symmetry in its AAA+ ring, suggesting a functional relationship between asymmetry and catalytic activity . This symmetry mismatch between the ATPase and protease moieties may be essential for the catalytic cycle, similar to other AAA+ protease complexes like ClpXP, which combines a hexameric ClpX ATPase with a heptameric ClpP protease .

The observed distortion of symmetry from C6 to C2 in related hexameric ATPases has been interpreted as evidence for sequential nucleotide hydrolysis and substrate translocation . This suggests that FtsH3 may employ a similar sequential or "hand-over-hand" mechanism for ATP hydrolysis and substrate processing, where conformational changes propagate around the ring to drive substrate translocation through the central pore.

What are optimal expression systems for producing active recombinant Sorangium cellulosum FtsH3?

Based on successful approaches with other FtsH proteins, the following expression systems are recommended:

Expression SystemAdvantagesConsiderationsRecommended Tags
E. coli BL21(DE3) with pET vectorsHigh yield, economicalMay require solubility tags for membrane proteinsN-terminal His6-MBP or SUMO fusion
E. coli C41/C43(DE3)Specialized for membrane proteinsLower expression levels but better foldingC-terminal His8 tag with precision protease site
Insect cell/baculovirusBetter folding of complex proteinsHigher cost, longer timelineTwin-Strep tag for gentle purification

When expressing full-length FtsH3, consider:

  • Using low induction temperatures (16-18°C) to improve folding

  • Adding 0.1-0.5% mild detergents (DDM, LMNG) during lysis to solubilize membrane domains

  • Including 5-10% glycerol in all buffers to stabilize the complex

  • Supplementing with zinc ions (10-50 μM ZnCl2) to ensure metalloprotease activity

For structural studies, a truncated construct lacking the transmembrane domains but retaining both AAA+ and protease domains has proven successful for crystallization of FtsH homologs while maintaining caseinolytic and ATPase activities .

What assays can effectively measure FtsH3 ATPase and proteolytic activities?

Several complementary assays can be employed to measure the dual enzymatic activities of FtsH3:

ATPase Activity Assays:

  • Malachite Green Assay: Quantifies inorganic phosphate released during ATP hydrolysis. Simple colorimetric readout at 620-640 nm.

  • NADH-coupled assay: Couples ATP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase. Monitors decrease in absorbance at 340 nm.

  • Radioactive [γ-32P]ATP assay: Most sensitive method, measures release of 32P-labeled inorganic phosphate.

Proteolytic Activity Assays:

  • Caseinolytic assay: Measures degradation of fluorescein-labeled casein. Successfully used with soluble FtsH constructs .

  • Synthetic peptide substrates: FRET-based peptides that increase fluorescence upon cleavage.

  • Native substrate degradation: For known substrates, monitor degradation via western blotting. In Arabidopsis, degradation of Complex I subunits was monitored to assess FTSH3 activity .

Combined Functional Assays:

  • ATP-dependent proteolysis: Compare proteolytic activity with and without ATP to verify coupling.

  • ATPase activation: Measure enhancement of ATPase activity in presence of protein substrates.

For all assays, include appropriate controls:

  • Catalytically inactive mutants (proteolytic site or Walker B motif mutations)

  • Metal chelators (EDTA) to confirm zinc-dependence

  • ATPase inhibitors to verify specificity

How can site-directed mutagenesis inform understanding of FtsH3 function?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships in FtsH3. Key targets for mutagenesis include:

Proteolytic Domain:

  • Zinc coordination residues: Based on homology with other FtsH proteins, mutating the aspartic acid zinc ligand to alanine should abolish proteolytic activity without affecting ATPase function .

  • Catalytic residue mutations: Creating proteolytically inactive "TRAP" variants for studying ATPase-dependent functions independently .

ATPase Domain:

  • Walker A/B motifs: Mutations in these conserved motifs (e.g., K→A in Walker A or E→Q in Walker B) can abolish ATP binding or hydrolysis.

  • P415L equivalent: This mutation in Arabidopsis FTSH3 disrupted interaction with Complex I subunit PSST and altered substrate recognition .

Substrate Recognition Domains:

  • Pore loop residues: Aromatic-hydrophobic-glycine motifs in the central pore are critical for substrate engagement and translocation.

  • Mutations at the interface between ATPase and protease domains may affect communication between these functional units.

For complex analysis, combine mutagenesis with:

  • In vitro biochemical assays to assess changes in enzymatic parameters

  • Y2H or Co-IP studies to evaluate effects on protein-protein interactions

  • In vivo complementation to determine functional consequences

The P415L mutation identified in Arabidopsis FTSH3 provides a template for studying how subtle changes in the ATPase domain can significantly impact substrate selection and processing .

What approaches are effective for identifying FtsH3 substrates?

Identifying physiological substrates represents a major challenge in FtsH3 research. Several complementary approaches can help:

Proteomics-Based Methods:

  • Comparative proteomics: Compare protein abundance in wild-type versus FtsH3-deficient strains to identify accumulated substrates.

  • SILAC or TMT labeling: Use quantitative proteomics to measure protein turnover rates with and without functional FtsH3.

  • Proximity labeling: Fuse FtsH3 to BioID or APEX2 to biotinylate proximal proteins, enriching for potential substrates and interaction partners.

Biochemical Approaches:

  • Co-immunoprecipitation: Pull down FtsH3-substrate complexes using catalytically inactive "TRAP" variants that bind but don't degrade substrates .

  • In vitro degradation assays: Test candidate substrates with purified FtsH3 to verify direct proteolysis.

Genetic Screens:

  • Suppressor screens: Identify mutations that suppress phenotypes of FtsH3 deficiency, potentially revealing pathways affected by FtsH3.

  • Synthetic lethality screens: Identify genes whose function becomes essential when FtsH3 is compromised.

Based on findings in Arabidopsis, proteins at interfaces between membrane and soluble domains of large complexes (like the PSST subunit of Complex I) make excellent candidate substrates . The study of turnover rates of these proteins can provide insights into FtsH3's role in quality control of protein complexes.

How conserved is FtsH3 across bacterial species compared to Sorangium cellulosum?

FtsH proteases represent a universally conserved family across bacterial species, though with varying levels of sequence and functional conservation. While specific comparative data for S. cellulosum FtsH3 is limited in the provided references, general patterns in FtsH evolution suggest:

  • Core functional domains (ATPase and protease) show high conservation across diverse bacteria

  • Transmembrane regions and substrate-binding domains exhibit greater variability

  • Many bacteria contain multiple FtsH paralogs with specialized functions

S. cellulosum, as a myxobacterium with complex cellular behaviors and a large genome (>13 Mb for some strains), likely contains multiple FtsH homologs with specialized functions. The rich enzymatic diversity observed in S. cellulosum (with 406 potential lipolytic enzymes identified across 13 sequenced genomes ) suggests similar diversity may exist in its protease families.

Comparative analysis of multiple FtsH proteins from S. cellulosum could reveal specialization patterns and substrate preferences that have evolved in this complex bacterium.

What can evolutionary analysis tell us about the relationship between bacterial and eukaryotic FtsH homologs?

Evolutionary analysis reveals that eukaryotic FtsH homologs originated from bacterial ancestors through endosymbiotic events:

  • Mitochondrial FtsH proteins derived from the α-proteobacterial endosymbiont that gave rise to mitochondria

  • Chloroplast FtsH proteins derived from the cyanobacterial ancestor of chloroplasts

Evolutionary InnovationFunctional Consequence
Heteromeric complexesExpanded substrate specificity
Specialized orientations (i-AAA vs. m-AAA)Compartmentalized quality control
Integration with eukaryotic stress response systemsComplex regulation of activity

The connection between bacterial FtsH and human homologs has medical relevance, as mutations in human homologs cause neurodegenerative diseases including hereditary spastic paraplegia (HSP7) and spinocerebellar ataxia type 28 (SCA28) .

How do substrate recognition mechanisms differ between FtsH homologs?

Substrate recognition by FtsH proteases appears to involve multiple mechanisms that may differ between homologs:

  • Direct protein-protein interactions: As observed between Arabidopsis FTSH3 and the PSST subunit of Complex I, specific interaction domains mediate recognition . The N-terminal domain of PSST was found to interact with FTSH3, and a S70F mutation in this domain disrupted the interaction .

  • Recognition of damaged or unfolded states: FtsH proteases preferentially recognize substrates when they are misfolded or disassembled from their complexes . This may be a conserved feature across bacterial and eukaryotic homologs.

  • Complex-specific recognition: In eukaryotes, heteromeric complexes like AFG3L2/SPG7 may have evolved specialized substrate recognition properties .

  • Degron sequences: Some FtsH substrates contain specific sequence motifs that target them for degradation.

The weak unfoldase activity observed in bacterial FtsH (compared to other AAA+ proteases) suggests that substrate recognition often depends on prior destabilization of the target protein . This may explain why FtsH proteases are particularly important during stress conditions when protein damage is more prevalent.

How does research on bacterial FtsH3 inform understanding of human FtsH-related diseases?

Research on bacterial FtsH3 provides valuable insights for understanding human FtsH-related diseases through several mechanisms:

  • Structural basis of dysfunction: The conserved architecture of FtsH proteases means that structural studies of bacterial FtsH3 can inform how disease-causing mutations in human homologs disrupt function. The crystal structure showing the Asp-zincin active site and the asymmetric arrangement of AAA+ domains provides a framework for interpreting human mutations .

  • ATPase-protease coupling: Studies showing that the ATPase function of FtsH3 can be separated from its proteolytic activity help explain how certain disease mutations that don't affect the protease domain can still cause dysfunction.

  • Quality control mechanisms: Bacterial FtsH3's role in protein complex disassembly and turnover parallels the function of human mitochondrial FtsH homologs in maintaining organelle proteostasis, dysfunction of which leads to neurodegenerative diseases .

Human diseases linked to FtsH homologs include:

  • Hereditary spastic paraplegia (HSP7) caused by recessive mutations in SPG7 (paraplegin)

  • Spinocerebellar ataxia type 28 (SCA28) caused by mutations in AFG3L2

  • Other neuromuscular disorders including intellectual disability, motor developmental delay, optic atrophy, and movement deficiencies

The neurological focus of these disorders likely reflects the high energy demands of neurons and their sensitivity to mitochondrial dysfunction .

What model systems are most appropriate for studying FtsH3 in relation to human disease?

Several model systems can bridge bacterial FtsH3 research with human disease applications:

Model SystemAdvantagesLimitationsDisease Relevance
Yeast (S. cerevisiae)Eukaryotic mitochondria, genetic tractabilityDifferences in respiratory metabolismModels for AFG3L2/SPG7 function
C. elegansMulticellular, transparent, neuron visualizationSimpler nervous systemNeurodegeneration phenotypes
DrosophilaComplex nervous system, powerful geneticsDifferences in mitochondrial biologyLocomotor defects similar to ataxia
ZebrafishVertebrate model, transparent embryosLess established for mitochondrial studiesModels of axonal degeneration
MouseMammalian physiology, complex neuroanatomyHigher cost, longer generation timeDirect SPG7/AFG3L2 knockout models
Patient-derived iPSCsHuman genetic backgroundIn vitro limitationsNeurons with disease mutations

For specific aspects of FtsH function:

  • Bacterial systems: Best for basic mechanistic studies of FtsH3 structure and function

  • Yeast: Ideal for complementation studies testing human disease variants

  • Mammalian cell culture: Useful for mitochondrial function and stress response studies

  • Mouse models: Essential for understanding tissue-specific manifestations of FtsH dysfunction

Cross-species complementation approaches can be particularly informative - testing whether human FtsH homologs can rescue bacterial ftsH mutants, or vice versa, can reveal conserved functional domains and disease mechanisms.

What therapeutic strategies might emerge from understanding FtsH3 mechanisms?

Understanding the mechanisms of FtsH3 function suggests several potential therapeutic avenues for treating FtsH-related human diseases:

  • Enhancing remaining protease activity: For partial loss-of-function mutations, small molecules that stabilize remaining FtsH complexes could enhance residual activity.

  • Targeting parallel quality control pathways: Given the functional overlap between FtsH and other mitochondrial proteases , upregulating complementary quality control systems could compensate for FtsH deficiency.

  • Metabolic interventions: As FtsH-related diseases often involve energy deficiency due to impaired mitochondrial function , metabolic therapies that enhance ATP production through alternative pathways may prove beneficial.

  • Substrate-specific approaches: Identification of key substrates that accumulate in disease states could lead to targeted approaches to reduce their toxicity or enhance their clearance through alternate pathways.

  • Gene therapy approaches: For recessive conditions like HSP7, gene replacement strategies delivering functional SPG7 could potentially restore normal proteostasis.

Research on bacterial FtsH3 can inform drug design by:

  • Providing high-resolution structural information for rational drug design

  • Identifying key functional residues and domains as therapeutic targets

  • Establishing assay systems for screening compounds that modulate FtsH activity

  • Revealing conserved recognition motifs that could be mimicked by therapeutic peptides

A particular focus on the ATPase function of FtsH3, which appears crucial for substrate recognition independently of proteolytic activity , may reveal novel therapeutic targets for modulating FtsH activity in disease states.

What key knowledge gaps remain in our understanding of Sorangium cellulosum FtsH3?

Despite advances in understanding FtsH proteases, several critical knowledge gaps remain regarding Sorangium cellulosum FtsH3:

  • Substrate specificity: The natural substrates of S. cellulosum FtsH3 have not been comprehensively identified, limiting our understanding of its physiological roles.

  • Regulatory mechanisms: How FtsH3 activity is regulated in response to changing cellular conditions remains poorly characterized in S. cellulosum.

  • Structural details: High-resolution structures of S. cellulosum FtsH3 are not available, limiting structure-based approaches to understand its specific mechanisms.

  • Integration with cellular pathways: How FtsH3 function coordinates with other quality control systems in S. cellulosum needs further investigation.

  • Specialized adaptations: Whether S. cellulosum FtsH3 has evolved specialized features related to this bacterium's complex lifecycle and environmental adaptations remains unknown.

Addressing these gaps will require integrative approaches combining structural biology, proteomics, genetics, and biochemistry tailored to the challenges of working with this complex myxobacterium.

What emerging technologies might advance FtsH3 research?

Several emerging technologies hold promise for advancing our understanding of FtsH3:

  • Cryo-electron microscopy: For capturing dynamic states of FtsH3 during its catalytic cycle, including substrate engagement and translocation.

  • Integrative structural biology: Combining X-ray crystallography, cryo-EM, NMR, and computational modeling to build complete models of membrane-embedded FtsH3 complexes.

  • Single-molecule techniques: To observe FtsH3 function in real-time, providing insights into the coordination between ATPase cycles and proteolytic events.

  • Advanced proteomics: Techniques like BioID proximity labeling and SILAC pulse-chase could identify substrates and interaction partners in vivo.

  • CRISPR-based screens: For systematic identification of genetic interactions with FtsH3 in both bacterial and eukaryotic systems.

  • Microfluidic approaches: For high-throughput analysis of FtsH3 variants and their impact on cellular fitness under diverse conditions.

  • Computational approaches: Machine learning methods could predict substrate recognition patterns and functional consequences of sequence variations.

These technologies, applied to both bacterial FtsH3 and its eukaryotic homologs, promise to enhance our understanding of this important protease family and its roles in cellular homeostasis and disease.

How might interdisciplinary approaches accelerate progress in FtsH3 research?

Progress in understanding FtsH3 will benefit from interdisciplinary collaboration in several areas:

  • Structural biology and biochemistry: Determining high-resolution structures of FtsH3 in different functional states and with bound substrates.

  • Systems biology and proteomics: Identifying the complete set of FtsH3 substrates and interaction partners under different conditions.

  • Evolutionary biology and comparative genomics: Tracking the diversification of FtsH proteases across bacterial lineages and into eukaryotes.

  • Medical research and neuroscience: Connecting mechanisms of bacterial FtsH3 function to human disease processes in FtsH-related neurological disorders.

  • Synthetic biology and protein engineering: Developing modified FtsH3 variants with enhanced stability or altered substrate specificity for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.