Recombinant Sorangium cellulosum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; sce9363; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
atpF
Target Protein Sequence
MQPGRARPTPPPAQPEHASHGEGHCPGHGPTDPPPHVNWWHGLIGVNNEAAAKGGINALL WRYHNEQNPCDPKNEPPPFLASVLNFGLLALIVVRFGRKPIAEALKKRKQTITQELDNAS RLKQEAELRLEEYEDKLTRLEETLAELKAEHAAQAEVEKAHVLAEAEQRRVRMRRDAEFR AEQELKAARAMLLQEAVQNAVVAAEELLRQRIGQQDLDRVNEDYLKAIPAAVSAGARRGA QTTGAAT
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links

KEGG: scl:sce9363

STRING: 448385.sce9363

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Sorangium cellulosum ATP synthase subunit b (atpF) and what is its function?

ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex in Sorangium cellulosum, a soil-dwelling myxobacterium known for producing various bioactive secondary metabolites. The ATP synthase complex is responsible for ATP production through oxidative phosphorylation. Specifically, the b subunit is part of the membrane-embedded F0 sector of ATP synthase, which functions in proton translocation across the membrane. This subunit plays a structural role in connecting the F1 catalytic domain to the F0 proton channel, facilitating the conversion of the proton gradient energy into ATP synthesis .

The subunit b (atpF) from S. cellulosum consists of 247 amino acids and is encoded by the atpF gene (locus name sce9363). It functions as part of the stator structure that prevents rotation of certain components while allowing others to rotate during ATP synthesis .

How is recombinant S. cellulosum ATP synthase subunit b typically produced?

Recombinant S. cellulosum ATP synthase subunit b (atpF) is typically produced using heterologous expression systems, most commonly in Escherichia coli. The production process involves:

  • Gene cloning: The atpF gene (sce9363) is amplified from S. cellulosum genomic DNA and inserted into an appropriate expression vector.

  • Transformation: The recombinant expression vector is introduced into competent E. coli cells.

  • Expression: Bacterial cultures are grown under optimized conditions to express the recombinant protein, often with an affinity tag (determined during the production process) to facilitate purification.

  • Purification: The expressed protein is isolated using chromatographic techniques appropriate for the affinity tag.

  • Quality control: The purified protein undergoes validation testing for identity, purity, and integrity .

While E. coli is the predominant expression system, it's worth noting that heterologous expression in other organisms has been explored for similar proteins, as seen with other S. cellulosum components .

What are the optimal storage conditions for recombinant S. cellulosum atpF protein?

Based on established protocols, recombinant S. cellulosum ATP synthase subunit b should be stored according to the following guidelines:

  • Long-term storage: -20°C or -80°C for extended preservation

  • Buffer composition: Typically maintained in Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Working aliquots: Can be stored at 4°C for up to one week

  • Stability considerations: Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity

These storage recommendations are consistent with general practices for preserving recombinant protein stability and activity, particularly for membrane-associated proteins that may be prone to aggregation or denaturation.

What approaches can be used to study the interaction between atpF and other ATP synthase components?

Investigating the interactions between S. cellulosum atpF and other ATP synthase components requires sophisticated biochemical and biophysical approaches:

  • Cross-linking studies: Chemical cross-linking coupled with mass spectrometry can identify interaction sites between atpF and other subunits.

  • Co-immunoprecipitation assays: Using antibodies against atpF or epitope-tagged versions to pull down interacting partners.

  • Structural biology approaches:

    • X-ray crystallography of reconstituted subcomplexes

    • Cryo-electron microscopy for visualizing the intact ATP synthase complex

    • NMR spectroscopy for studying dynamic interactions in solution

  • Functional reconstitution: Incorporating purified recombinant atpF with other ATP synthase components in liposomes to assess functional interactions through ATP synthesis assays.

  • Mutagenesis studies: Site-directed mutagenesis of key residues predicted to be involved in subunit interactions, followed by functional assays to assess the impact on ATP synthase assembly and activity .

These approaches can provide complementary insights into both the static structure and dynamic interactions of atpF within the ATP synthase complex.

How might the unique properties of S. cellulosum atpF be exploited in structural biology research?

The recombinant S. cellulosum ATP synthase subunit b presents several opportunities for structural biology research:

  • Comparative structural studies: The unique sequence characteristics of S. cellulosum atpF make it valuable for evolutionary studies of ATP synthase structure and function across diverse bacterial lineages.

  • Stability advantages: The adaptation of S. cellulosum to complex environmental conditions may confer enhanced stability to its ATP synthase components, potentially making atpF more amenable to crystallization or other structural determinations than homologs from other species.

  • Novel interaction interfaces: The unique regions in S. cellulosum atpF may reveal previously uncharacterized interaction motifs that contribute to ATP synthase assembly or regulation.

  • Functional reconstitution systems: Recombinant atpF can be incorporated into artificial membrane systems to study proton translocation and energy coupling mechanisms in a controlled environment .

These properties make S. cellulosum atpF a valuable target for researchers seeking to understand fundamental aspects of bioenergetics and membrane protein complex assembly.

What purification strategies are most effective for recombinant S. cellulosum atpF?

Effective purification of recombinant S. cellulosum ATP synthase subunit b requires a strategic approach that accounts for its membrane association and structural characteristics:

  • Affinity chromatography: The primary purification step typically employs tag-based affinity purification. While the specific tag is determined during the production process, common options include:

    • His-tag purification using nickel or cobalt affinity resins

    • GST-tag purification

    • MBP-tag purification for enhanced solubility

  • Detergent considerations: As a membrane-associated protein, proper solubilization is critical. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are often employed to maintain native-like structure.

  • Secondary purification steps:

    • Size exclusion chromatography to separate properly folded monomers from aggregates

    • Ion exchange chromatography for further purification based on charge properties

  • Quality assessment:

    • SDS-PAGE analysis confirms purity (typically >90%)

    • Western blotting verifies identity

    • Circular dichroism spectroscopy assesses secondary structure integrity

The optimal purification strategy may need to be empirically determined for each expression construct and downstream application.

How can researchers validate the functional integrity of purified recombinant atpF?

Validating the functional integrity of purified recombinant S. cellulosum ATP synthase subunit b requires multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure formation

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to assess proper folding

  • Binding assays:

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to quantify interactions with known binding partners

    • Pull-down assays with other ATP synthase components

  • Reconstitution experiments:

    • Incorporation into liposomes with other ATP synthase components

    • Proton translocation assays using pH-sensitive fluorescent dyes

    • ATP synthesis activity measurements when combined with complementary subunits

  • Comparative analysis:

    • Side-by-side functional comparison with native ATP synthase complex

    • Complementation studies in ATP synthase-deficient bacterial strains

These approaches collectively provide a comprehensive assessment of whether the recombinant atpF protein maintains its native structure and function.

What experimental systems are suitable for studying S. cellulosum ATP synthase assembly and function?

Several experimental systems can be employed to study the assembly and function of S. cellulosum ATP synthase involving the atpF subunit:

  • Heterologous expression systems:

    • E. coli expression systems for individual subunit production

    • Bacillus subtilis for expression of membrane proteins

    • Cell-free protein synthesis systems for direct incorporation into artificial membranes

  • Reconstitution approaches:

    • Proteoliposomes incorporating purified ATP synthase components

    • Nanodiscs for single-molecule studies

    • Planar lipid bilayers for electrophysiological measurements

  • Fluorescence-based assays:

    • FRET (Förster Resonance Energy Transfer) to monitor subunit interactions

    • Fluorescence correlation spectroscopy for dynamic assembly studies

  • Genetic systems:

    • Although S. cellulosum has been described as difficult to genetically manipulate, targeted approaches using TALEN gene knockout systems have been successful for other genes

    • Heterologous expression of S. cellulosum components in more tractable bacterial hosts

The choice of experimental system should be guided by the specific research question and the technical limitations of working with membrane protein complexes.

What are the key considerations when designing experiments to study atpF interactions with other ATP synthase components?

When designing experiments to investigate interactions between S. cellulosum atpF and other ATP synthase components, researchers should consider:

  • Protein solubilization strategies:

    • Selection of appropriate detergents that maintain native-like membrane protein structure

    • Nanodiscs or amphipols as alternatives to detergents for maintaining a membrane-like environment

    • Detergent-free systems for specific applications

  • Interaction detection methods:

    • Label-based approaches (FRET, BRET) versus label-free methods (SPR, ITC)

    • Sensitivity and signal-to-noise considerations for low-affinity interactions

    • Time resolution requirements for transient interactions

  • Potential artifacts:

    • Tag interference with native interactions

    • Detergent effects on protein-protein interactions

    • Non-physiological salt or pH conditions

  • Controls and validation:

    • Known interaction partners as positive controls

    • Non-interacting proteins as negative controls

    • Orthogonal methods to confirm detected interactions

  • Quantitative analysis:

    • Determination of binding affinities and kinetics

    • Stoichiometry of interactions

    • Influence of environmental factors (pH, ion concentrations)

Careful consideration of these factors will enhance the reliability and biological relevance of interaction studies.

How can recombinant S. cellulosum atpF contribute to comparative studies of ATP synthase evolution?

Recombinant S. cellulosum ATP synthase subunit b can serve as a valuable tool in evolutionary studies of ATP synthase for several reasons:

  • Phylogenetic positioning: S. cellulosum belongs to the myxobacteria, a group with unique evolutionary history, allowing investigation of ATP synthase adaptation in this lineage.

  • Structural conservation analysis: Comparison of S. cellulosum atpF with homologs from diverse organisms can reveal:

    • Core conserved residues essential for function across all domains of life

    • Lineage-specific adaptations that reflect ecological niches

    • Co-evolution patterns with interacting subunits

  • Functional conservation testing: Recombinant atpF can be used in complementation studies with ATP synthase components from other species to determine functional interchangeability.

  • Molecular clock applications: The rate of sequence divergence in atpF compared to other ATP synthase components can provide insights into evolutionary constraints and selection pressures.

This comparative approach can yield insights into both the fundamental mechanisms of ATP synthesis and the evolutionary history of this essential molecular machine .

What insights can atpF research provide about ATP synthase assembly mechanisms?

Research on S. cellulosum atpF can provide valuable insights into ATP synthase assembly through several investigative approaches:

  • Assembly intermediate identification: Using partially assembled complexes containing atpF to study the stepwise assembly pathway of ATP synthase.

  • Interaction network mapping: Systematic analysis of atpF interactions with other subunits can reveal:

    • The order of subunit incorporation during assembly

    • Critical interfaces that guide complex formation

    • Potential assembly chaperones or facilitators

  • Structure-function relationships: Mutagenesis of specific atpF domains followed by assembly assays can identify regions critical for:

    • Initial membrane insertion

    • Oligomerization with other stator components

    • Integration into the full ATP synthase complex

  • Species-specific assembly factors: Comparison with assembly pathways in other organisms may reveal unique features of S. cellulosum ATP synthase biogenesis related to its complex lifecycle and differentiation patterns .

Understanding these assembly mechanisms has broader implications for membrane protein complex biogenesis and could inform synthetic biology approaches for creating novel energy-transducing systems.

How might the study of S. cellulosum atpF contribute to understanding bacterial differentiation and development?

The study of ATP synthase subunit b from S. cellulosum can provide unexpected insights into bacterial differentiation and development processes, as evidenced by related research:

  • Metabolic regulation during differentiation: S. cellulosum undergoes complex life cycle transitions, including the formation of multicellular fruiting bodies. Energy metabolism, including ATP synthase function, is likely differentially regulated during these transitions.

  • Connection to stringent response: Research has shown that the rel gene in S. cellulosum, which controls the stringent response through (p)ppGpp synthesis, affects morphological and physiological differentiation. This regulatory system likely influences ATP synthase expression and assembly during different developmental stages.

  • Biofilm formation connections: S. cellulosum produces secondary metabolites like carolacton that affect biofilm formation in other bacteria. The potential relationship between energy metabolism, ATP synthase function, and secondary metabolite production during different growth phases merits investigation.

  • Developmental expression patterns: Studies of atpF expression during different stages of S. cellulosum development could reveal how energy production is coordinated with morphological changes and secondary metabolite production .

This research direction connects fundamental bioenergetics to complex bacterial behaviors and developmental biology.

What are common challenges in recombinant expression of S. cellulosum atpF and how can they be addressed?

Researchers working with recombinant S. cellulosum ATP synthase subunit b may encounter several challenges that can be addressed with specific strategies:

ChallengeCauseSolution Strategies
Poor expression yieldCodon usage differences between S. cellulosum and expression host- Use codon-optimized synthetic gene
- Express in Rosetta or other strains supplying rare tRNAs
- Reduce expression temperature to 16-18°C
Protein insolubilityMembrane protein characteristics- Use solubility-enhancing fusion partners (MBP, SUMO)
- Optimize detergent selection and concentration
- Consider cell-free expression systems with lipid nanodiscs
Protein aggregationImproper folding- Co-express with molecular chaperones
- Include stabilizing agents in purification buffers
- Screen multiple detergents and buffer conditions
Proteolytic degradationSusceptibility to host proteases- Add protease inhibitors throughout purification
- Include stabilizing ligands during purification
- Use protease-deficient expression strains
Low purityNon-specific interactions- Implement two-step or multi-step purification
- Optimize wash stringency in affinity purification
- Consider on-column refolding protocols

These strategies should be systematically evaluated to determine the optimal expression and purification conditions for each specific construct and application .

How can researchers optimize activity assays for ATP synthase studies involving recombinant atpF?

Optimizing activity assays for ATP synthase studies involving recombinant S. cellulosum atpF requires careful consideration of several factors:

  • Reconstitution parameters:

    • Lipid composition: Screen multiple lipid types and ratios to mimic native membrane environment

    • Protein-to-lipid ratio: Optimize to avoid protein crowding or excessive dilution

    • Reconstitution method: Compare gentle dialysis versus rapid dilution approaches

  • Assay conditions optimization:

    • pH gradient establishment: Test different methods for generating stable pH gradients

    • Temperature sensitivity: Determine optimal temperature range for S. cellulosum ATP synthase activity

    • Buffer composition: Screen ionic strength and specific ion requirements

  • Detection system selection:

    • ATP production: Luciferase-based assays for high sensitivity

    • Proton translocation: pH-sensitive fluorescent dyes with appropriate spectral properties

    • Rotation: Fluorescently labeled subunits for single-molecule studies

  • Controls and standards:

    • Positive controls: Well-characterized ATP synthase from model organisms

    • Negative controls: Inactive variants through specific inhibitors or mutations

    • Internal standards: Calibration curves for quantitative measurements

Systematic optimization of these parameters will enhance the reliability and sensitivity of functional assays.

What strategies are effective for improving the stability of purified recombinant S. cellulosum atpF?

Enhancing the stability of purified recombinant S. cellulosum ATP synthase subunit b can be achieved through several complementary approaches:

  • Buffer optimization:

    • Screen various pH values to identify stability optima

    • Test different buffer systems (Tris, HEPES, phosphate) for compatibility

    • Evaluate additives like trehalose (6%) for stabilization during lyophilization

  • Storage conditions:

    • Maintain at -20°C or -80°C for long-term storage

    • Prepare working aliquots to avoid freeze-thaw cycles

    • Consider flash-freezing in liquid nitrogen to preserve structure

  • Stabilizing additives:

    • Glycerol (50%) to prevent freeze damage and stabilize structure

    • Specific ions that enhance stability (determined empirically)

    • Mild detergents at concentrations above CMC but below destabilizing levels

  • Formulation strategies:

    • Lyophilization with appropriate cryoprotectants for room-temperature stability

    • Immobilization on solid supports for specific applications

    • Co-purification with natural binding partners to stabilize native conformation

Implementation of these strategies should be guided by the intended downstream applications and empirical stability testing.

How might emerging structural biology techniques advance our understanding of S. cellulosum ATP synthase?

Emerging structural biology techniques offer new opportunities to enhance our understanding of S. cellulosum ATP synthase and the role of subunit b:

  • Cryo-electron microscopy advances:

    • Single-particle analysis at near-atomic resolution can reveal detailed interactions between atpF and other subunits

    • Cryo-electron tomography can visualize ATP synthase in its native membrane environment

    • Time-resolved cryo-EM could potentially capture different conformational states during the catalytic cycle

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR spectroscopy, and computational modeling to build comprehensive structural models

    • Mass spectrometry-based footprinting to map interaction surfaces

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamics and conformational changes

  • Single-molecule techniques:

    • High-speed AFM to visualize conformational dynamics in real-time

    • Single-molecule FRET to measure distances between subunits during function

    • Magnetic tweezers or optical traps to study mechanical properties of the stator complex

  • Computational approaches:

    • Molecular dynamics simulations to model membrane integration and subunit interactions

    • Coevolution analysis to predict critical interaction interfaces

    • AlphaFold2 and other AI-based structure prediction tools to model full complex assembly

These approaches promise to reveal how the unique features of S. cellulosum ATP synthase contribute to its function in this environmentally and biotechnologically important organism.

What potential applications exist for recombinant S. cellulosum atpF beyond basic research?

Beyond fundamental research, recombinant S. cellulosum ATP synthase subunit b holds potential for several innovative applications:

  • Biotechnological applications:

    • Development of nano-scale energy-generating systems

    • Creation of ATP-regenerating systems for cell-free biotransformations

    • Design of biosensors based on ATP synthase activity

  • Structural biology tools:

    • Use as a scaffold for membrane protein crystallization

    • Development of novel membrane protein expression and purification strategies

    • Creation of fusion proteins for membrane localization of other proteins of interest

  • Antimicrobial development:

    • Target for novel antibiotics against related pathogenic bacteria

    • Structure-based design of inhibitors affecting ATP synthase assembly

    • Understanding of resistance mechanisms to ATP synthase-targeting compounds

  • Biophysical research tools:

    • Model system for studying protein-lipid interactions

    • Investigation of membrane protein folding and stability principles

    • Platform for testing membrane protein reconstitution methodologies

These applications leverage the unique properties of S. cellulosum atpF while contributing to broader research and technological goals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.