Recombinant Sorangium cellulosum ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization of ATP Synthase Subunit c

ATP synthase subunit c, also known as atpE or lipid-binding protein, is a crucial component of the F0 sector of ATP synthase, the molecular machine responsible for ATP production in cells. In Sorangium cellulosum, this protein consists of 112 amino acids in its full-length form, with the amino acid sequence: MSLKSKLSLSAVVGTALVLVPAMALAQDGAASNKYDANSWLAVAAGFAIGIAALGGTMGQGRAAAAALEGISRNPGAAARIQTPMILGLALIESLVLLSWVIAFFLQGKIAP . This protein is identified in the UniProt database with the accession number A9FGS9, facilitating its recognition in proteomic databases and research literature .

The atpE protein forms a critical part of the cylindrical c-ring oligomer in the F0 sector of ATP synthase. This structure directly participates in the proton pumping process that couples the proton gradient generated by the respiratory chain to ATP synthesis . While the mature protein is highly conserved across many species, variations in the N-terminal mitochondrial targeting peptides have been observed in different organisms, suggesting specialized roles beyond mere protein localization .

Expression Systems

Recombinant Sorangium cellulosum ATP synthase subunit c is typically produced using Escherichia coli expression systems. The gene encoding the protein is cloned into suitable expression vectors and transformed into E. coli host cells for protein production . This approach allows for high-yield production of the protein under controlled laboratory conditions.

The development of gene transfer systems for Sorangium cellulosum has been a significant advancement in this field. Recombinant vectors derived from broad-host-range mobilizable plasmids, such as pSUP2021, have been constructed and transferred by IncP-mediated conjugation from E. coli to Sorangium cellulosum, enabling integration into the chromosome by homologous recombination . This represents an important strategy for genetic manipulation of this organism, potentially allowing for modified expression of atpE and other proteins of interest.

Protein Tags and Purification

To facilitate purification and detection, the recombinant atpE protein is often expressed with fusion tags. A common approach is the addition of an N-terminal histidine (His) tag, which enables efficient purification using metal affinity chromatography . The resulting protein product typically demonstrates high purity, with greater than 90% purity as determined by SDS-PAGE analysis .

The recombinant protein is commonly supplied in lyophilized powder form, requiring reconstitution before use. The recommended reconstitution procedure involves dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Functional Significance in ATP Synthesis

ATP synthase is a crucial enzyme complex responsible for the production of adenosine triphosphate (ATP), the primary energy currency of cells. The enzyme operates through a rotary mechanism, where the F0 sector (containing subunit c) facilitates proton translocation across the membrane, driving the rotation of the central stalk and catalyzing ATP synthesis in the F1 sector .

Role of Subunit c in Energy Conversion

The subunit c (atpE) plays a pivotal role in this process by forming the c-ring, which directly cooperates with subunit a (Atp6-equivalent) in the proton pumping process . The c-ring rotates as protons pass through the membrane, converting the energy of the proton gradient into mechanical rotation that drives ATP synthesis.

Research on mammalian ATP synthase subunit c has revealed the existence of multiple isoforms that differ by their mitochondrial targeting peptides while maintaining identical mature peptides. Interestingly, these isoforms are not functionally redundant, as silencing any individual isoform results in ATP synthesis defects . This suggests that the targeting peptides play additional roles beyond protein import, including maintenance of respiratory chain structure and function . While this specific research was conducted on mammalian systems, it provides valuable insights into the potential complexity of ATP synthase subunit c function across different organisms, including Sorangium cellulosum.

Research Context and Genomic Background

Sorangium cellulosum is a gram-negative myxobacterium known for its large genome and complex metabolic capabilities. The So0157-2 strain of Sorangium cellulosum possesses a genome of 14,782,125 base pairs, making it one of the largest bacterial genomes known . This extraordinary genome size includes massive duplications and horizontally transferred genes, which provide the organism with abundant resources and flexibility for ecological adaptation .

Genomic Context of atpE

The atpE gene is part of the ATP synthase operon in Sorangium cellulosum. The expression of this gene, along with other components of the ATP synthase complex, is likely regulated by protein kinases, sigma factors, and related transcriptional regulators that are abundant in the Sorangium cellulosum genome . This complex regulatory network allows the organism to adapt its energy metabolism to different environmental conditions.

Comparative Analysis with Other ATP Synthase Components

In addition to atpE, other ATP synthase components from Sorangium cellulosum have been studied. For instance, the ATP synthase subunit alpha (atpA) has been expressed as a recombinant protein and characterized . Comparative analysis of these subunits can provide a more comprehensive understanding of the ATP synthase complex in this organism and its role in cellular energetics.

Applications in Research and Biotechnology

Recombinant Sorangium cellulosum ATP synthase subunit c has several potential applications in research and biotechnology:

Antibody Production and Immunoassays

Recombinant atpE can be used as an antigen for antibody production. The resulting antibodies can be employed in various immunological techniques, including immunoblotting, immunoprecipitation, and immunohistochemistry, to study the expression and localization of ATP synthase in cells.

Drug Discovery

ATP synthase is a potential target for antimicrobial drugs. The availability of recombinant atpE enables screening assays to identify compounds that specifically interact with this protein, potentially leading to the development of new antibiotics targeting energy metabolism in bacteria.

Future Research Directions

Research on Recombinant Sorangium cellulosum ATP synthase subunit c continues to evolve, with several promising directions for future investigation:

Structure-Function Relationships

Detailed structural studies of atpE can provide insights into the molecular mechanisms of proton translocation and energy coupling in ATP synthase. This knowledge can contribute to our understanding of bioenergetics and potentially inspire the design of artificial energy-transducing systems.

Comparative Analysis Across Species

Comparative analysis of ATP synthase subunit c from different species can reveal evolutionary patterns and functional adaptations. This approach can help identify conserved features essential for function and variable regions that might contribute to species-specific characteristics.

Biotechnological Applications

The development of improved expression systems for Sorangium cellulosum proteins, including atpE, can facilitate the production of this protein for various biotechnological applications. Additionally, engineering atpE with modified properties could lead to novel applications in bioenergetics and synthetic biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpE; sce7980; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
atpE
Target Protein Sequence
MSLKSKLSLSAVVGTALVLVPAMALAQDGAASNKYDANSWLAVAAGFAIGIAALGGTMGQ GRAAAAALEGISRNPGAAARIQTPMILGLALIESLVLLSWVIAFFLQGKIAP
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are linked via a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. A key component of the F(0) channel, subunit c directly participates in transmembrane translocation. A homomeric c-ring, consisting of 10-14 subunits, forms the central stalk rotor element in conjunction with the F(1) delta and epsilon subunits.
Database Links

KEGG: scl:sce7980

STRING: 448385.sce7980

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit c (AtpE) and what is its role in cellular energetics?

ATP synthase subunit c (AtpE) is a crucial component of the F1F0-ATP synthase complex, responsible for catalyzing ATP production from ADP in the presence of a sodium or proton gradient . The subunit c proteins assemble into a cylindrical oligomer (typically c10) that forms the membrane-embedded rotor of the ATP synthase . This rotor directly cooperates with subunit a in the proton pumping process that couples the proton gradient generated by the respiratory chain to ATP synthesis .

In the functional mechanism, subunit c rotates as protons pass through the membrane domain, and this mechanical rotation drives conformational changes in the F1 catalytic domain where ATP is synthesized. This conversion of the electrochemical potential energy stored in the proton gradient into the chemical energy of ATP represents one of the most fundamental processes in cellular bioenergetics .

How does recombinant AtpE from Sorangium cellulosum differ from ATP synthase subunit c in other organisms?

While the search results don't specifically detail Sorangium cellulosum AtpE, research on ATP synthase subunit c across different organisms reveals important variations. The most significant differences typically occur in:

  • Primary sequence conservation: The mature peptide of subunit c is highly conserved across species, but can contain organism-specific variations that affect inhibitor binding sites and functional properties .

  • Oligomeric ring structure: The number of c-subunits in the ring can vary between species (ranging from 8-15 subunits), affecting the bioenergetic efficiency of ATP production .

  • Post-translational modifications: Different organisms may employ specific modifications to regulate AtpE function and assembly.

  • Targeting sequences: In eukaryotes like mammals, ATP synthase subunit c isoforms differ primarily in their organelle targeting peptides, which play additional roles beyond protein import, including respiratory chain maintenance .

These differences are critical considerations when working with recombinant AtpE from specific organisms, as they influence protein expression, purification strategies, and functional characterization approaches .

What are the optimal expression systems for recombinant Sorangium cellulosum AtpE production?

Based on established protocols for ATP synthase subunit c expression, several systems can be employed for recombinant Sorangium cellulosum AtpE production, each with specific advantages:

  • E. coli Expression System: The most commonly used approach involves recombinant E. coli strains such as BL21(DE3) containing appropriate expression vectors (like pET22b(+)) . For optimal expression:

    • Culture in rich media (HB or LB) supplemented with appropriate antibiotics

    • Grow cultures at 37°C until OD600 reaches 0.7

    • Cold-shock cells on ice for 30 minutes before induction

    • Induce with low IPTG concentrations (approximately 20 μM)

    • Supplement with 5-aminolevulinic acid (ALA, 200 μM) if a heme-containing protein is involved

    • Continue expression at reduced temperature (20°C) for 22 hours

  • Cell-Free Expression Systems: For difficult-to-express membrane proteins like AtpE, cell-free systems can overcome toxicity issues associated with membrane protein overexpression.

  • Specialized Host Strains: C41(DE3) or C43(DE3) E. coli strains specially designed for membrane protein expression may provide higher yields.

The choice of expression system should be determined by the specific experimental needs, including required yield, downstream applications, and whether post-translational modifications are needed .

What purification strategies yield the highest purity and stability for recombinant AtpE?

Purification of recombinant AtpE presents challenges due to its hydrophobic nature and tendency to form oligomeric structures. The following multi-step purification protocol yields optimal results:

  • Cell Lysis: Sonication in buffer containing 100 mM NaCl, 20 mM imidazole, and 20 mM Tris-HCl (pH 7.5) (2 minutes, 2 seconds on/off cycles, 40% duty cycle) .

  • Initial Clarification: Remove cell debris by centrifugation (5000×g, 4°C, 20 minutes) .

  • Membrane Fraction Isolation: Ultracentrifuge the supernatant (100,000×g, 1 hour, 4°C) to isolate membrane fractions containing AtpE.

  • Detergent Solubilization: Solubilize membrane proteins using appropriate detergents (n-dodecyl-β-D-maltoside or digitonin) at concentrations above their critical micelle concentration.

  • Affinity Chromatography: If His-tagged, use Ni-NTA affinity chromatography with imidazole gradient elution.

  • Size-Exclusion Chromatography: Further purify using size-exclusion chromatography to separate monomeric from oligomeric forms.

  • Quality Control: Assess purity by SDS-PAGE and Western blotting, and verify protein identity using mass spectrometry.

For long-term stability, store purified AtpE in buffer containing appropriate detergent at concentrations above CMC, with addition of glycerol (10-20%) at -80°C, avoiding repeated freeze-thaw cycles .

How can the native oligomeric structure of AtpE be maintained during recombinant expression and purification?

Maintaining the native oligomeric structure of AtpE is critical for functional studies and requires specific considerations throughout the expression and purification process:

  • Co-expression with Assembly Factors: Consider co-expressing AtpE with known assembly factors or chaperones that facilitate proper oligomerization.

  • Gentle Extraction Conditions: Use mild detergents for membrane protein extraction, such as digitonin (1-2%) or n-dodecyl-β-D-maltoside (0.5-1%), that preserve protein-protein interactions.

  • Stabilizing Buffer Components: Include lipids or lipid-like molecules in purification buffers (e.g., phosphatidylcholine at 0.1-0.5 mg/mL) to stabilize the oligomeric form.

  • Crosslinking Approaches: Employ mild chemical crosslinking (e.g., DSP or glutaraldehyde at low concentrations) to stabilize the oligomeric complex during purification.

  • Blue Native PAGE Analysis: Monitor oligomeric state throughout purification using Blue Native PAGE rather than denaturing SDS-PAGE.

  • Cryo-preservation Methods: Use rapid freezing techniques such as vitrification for sample storage to minimize structural disruption of oligomers.

The c-subunit oligomer structure (typically c10) is critical for ATP synthase function, as it forms the cylindrical rotor that directly participates in the proton pumping process coupled to ATP synthesis . Maintaining this structure is essential for mechanistic and inhibitor binding studies involving recombinant AtpE .

What computational methods are most effective for modeling the structure of Sorangium cellulosum AtpE?

For accurate structural modeling of Sorangium cellulosum AtpE, a comprehensive computational approach is recommended:

  • Homology Modeling Pipeline:

    • Template Selection: Identify suitable templates from structurally characterized ATP synthase subunit c proteins using BLAST and HHpred

    • Sequence Alignment: Perform multiple sequence alignment between the target and template sequences using CLUSTALW or MUSCLE

    • Model Building: Generate 3D models using Modeller9.16 based on spatial restraints, including hydrogen bonds, main chain, side chain, and dihedral angle information

    • Model Selection: Generate multiple models (minimum 10) and select the one with the lowest Discrete Optimized Protein Energy (DOPE) value

  • Energy Minimization and Refinement:

    • Perform energy minimization using molecular dynamics simulation (10 ns minimum) via AMBERTOOLS10

    • Stabilize the model structure to eliminate van der Waals repulsion energy and steric clashes before docking studies

  • Model Validation:

    • Superimpose the model with template structures to calculate RMSD values (values <1.0 Å indicate highly reliable models)

    • Evaluate stereochemical quality using Ramachandran plot analysis, ERRAT, and Verify_3D tools

    • Validate protein-protein interfaces if modeling the entire c-ring structure

For Sorangium cellulosum AtpE specifically, this computational approach would identify structural features relevant to inhibitor binding and functional mechanisms, enabling structure-based drug design and mechanistic studies .

What experimental methods provide the most accurate structural information for recombinant AtpE?

Due to the challenging nature of membrane protein structural determination, a multi-method approach provides the most comprehensive structural characterization of recombinant AtpE:

  • X-ray Crystallography:

    • Optimize crystallization conditions using vapor diffusion methods with detergent screens

    • Consider lipidic cubic phase (LCP) crystallization for membrane proteins

    • Use synchrotron radiation for high-resolution diffraction data collection

    • Challenges include obtaining diffraction-quality crystals of membrane proteins

  • Cryo-Electron Microscopy:

    • Particularly suitable for visualizing the c-ring oligomeric structure

    • Vitrify purified AtpE samples on holey carbon grids

    • Collect data using direct electron detectors and perform image processing

    • Can achieve near-atomic resolution for membrane protein complexes

  • NMR Spectroscopy:

    • Solution NMR or solid-state NMR with isotope labeling (15N, 13C)

    • Provides dynamic information not accessible by static methods

    • Particularly useful for studying inhibitor binding and conformational changes

  • Mass Spectrometry Approaches:

    • Native MS to determine oligomeric state and stoichiometry

    • Hydrogen-deuterium exchange MS to probe solvent accessibility

    • Crosslinking MS to map protein-protein interaction interfaces

  • Site-Directed Spin Labeling with EPR:

    • Introduce spin labels at specific residues to probe local environment

    • Monitor conformational changes during catalytic cycle

Each method provides complementary information, and the integration of multiple approaches yields the most comprehensive structural characterization of recombinant AtpE .

How can the proton-translocation function of recombinant AtpE be accurately measured in vitro?

Measuring the proton translocation function of recombinant AtpE requires specialized techniques that monitor proton movement across membranes:

  • Liposome Reconstitution System:

    • Reconstitute purified AtpE into liposomes prepared from E. coli total lipid extract or defined phospholipid mixtures

    • Incorporate pH-sensitive fluorescent dyes (e.g., ACMA, pyranine) inside liposomes during preparation

    • Generate pH gradient using ionophores or by creating K+ diffusion potential

    • Monitor fluorescence changes in response to proton translocation

  • Patch-Clamp Electrophysiology:

    • Form proteoliposomes with reconstituted AtpE

    • Perform patch-clamp recordings to directly measure ion conductance

    • Characterize single-channel properties and ion selectivity

  • Solid-Supported Membrane (SSM)-Based Electrophysiology:

    • Adsorb proteoliposomes onto a solid-supported membrane

    • Measure transient currents in response to rapid solution exchange

    • Quantify proton transport rates and substrate dependencies

  • Proton Flux Measurements:

    • Monitor pH changes using pH-sensitive microelectrodes

    • Measure proton consumption or production rates using pH-stat methods

    • Calculate proton translocation rates under different conditions

To verify that observed activities are specific to AtpE function, control experiments should include:

  • Specific inhibitors of ATP synthase subunit c (e.g., oligomycin or venturicidin)

  • Reconstituted liposomes lacking AtpE

  • AtpE variants with mutations in key residues involved in proton translocation

What methodologies are most effective for screening potential inhibitors of Sorangium cellulosum AtpE?

Effective inhibitor screening for Sorangium cellulosum AtpE requires a multi-tiered approach combining computational and experimental methods:

  • In Silico Screening Approach:

    • Prepare the AtpE structure using AutoDock4.2 tool, converting to PDBQT file format

    • Calculate gasteiger charges and set grid parameters (60 × 60 × 60 with 0.375 Å spacing)

    • Perform virtual screening of compound libraries using Lamarckian genetic algorithms

    • Calculate binding free energies and rank compounds based on predicted affinity

    • Analyze protein-ligand complexes using Pymol and Ligplot+ to identify key interactions

  • Biochemical Assays for Primary Screening:

    • ATP synthesis inhibition assay using reconstituted AtpE in proteoliposomes

    • Oxygen consumption measurements using Clark-type electrode to assess respiratory chain inhibition

    • Competitive binding assays with known inhibitors (radio-labeled or fluorescent)

  • Biophysical Methods for Hit Validation:

    • Microscale thermophoresis (MST) to measure direct binding affinity

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

    • Surface plasmon resonance (SPR) to evaluate association/dissociation kinetics

  • Cellular Validation Assays:

    • Growth inhibition assays in bacterial cultures

    • Membrane potential measurements using voltage-sensitive dyes

    • ATP production quantification in cellular systems

Screening MethodThroughputInformation ObtainedTechnical Complexity
Virtual ScreeningHigh (10⁴-10⁶)Binding mode, energyModerate
ATP Synthesis AssayMedium (10²-10³)Functional inhibitionHigh
Oxygen ConsumptionLow (10¹-10²)Respiratory inhibitionHigh
MST/ITC/SPRLow (10¹-10²)Binding kinetics, affinityHigh
Cell-Based AssaysMedium (10²-10³)Cellular efficacyModerate

This tiered approach enables efficient identification and validation of potent and selective AtpE inhibitors while minimizing false positives .

How do mutations in AtpE affect inhibitor binding and resistance mechanisms?

Mutations in ATP synthase subunit c can significantly impact inhibitor binding and confer resistance through multiple mechanisms. Research on this topic reveals:

  • Key Residues Affecting Inhibitor Binding:

    • Mutations in the transmembrane helices that form the c-ring can alter binding site geometry

    • Changes in key polar or charged residues involved in direct interactions with inhibitors

    • Modifications to hydrophobic residues that contribute to binding pocket formation

  • Resistance Mechanisms:

    • Altered binding site accessibility preventing inhibitor entry

    • Reduced binding affinity through disruption of key interaction points

    • Structural rearrangements that maintain function while changing inhibitor recognition

    • Compensatory mutations that restore ATP synthase function despite inhibitor presence

  • Experimental Approaches to Study Resistance:

    • Site-directed mutagenesis to introduce specific mutations in recombinant AtpE

    • Directed evolution approaches to identify resistance mutations under selective pressure

    • Comparative binding studies with wild-type and mutant proteins using biophysical methods

    • Structural analysis of inhibitor binding to mutant proteins

    • Functional assays to determine impact of mutations on catalytic activity

The development of resistance to ATP synthase inhibitors often involves a balance between maintaining enzymatic function while reducing inhibitor sensitivity. For example, research on self-resistance mechanisms has shown that specialized genes like corB can confer resistance without directly altering the AtpE structure, suggesting alternative resistance pathways involving proteases that may degrade or modify inhibitors .

How can recombinant AtpE be utilized in the development of novel antimicrobials?

Recombinant AtpE serves as a powerful platform for antimicrobial development through several research approaches:

  • Structure-Based Drug Design Pipeline:

    • Use high-resolution structural data from recombinant AtpE to identify binding pockets

    • Employ computational docking studies to design compounds targeting AtpE-specific sites

    • Perform structure-activity relationship (SAR) analysis to optimize lead compounds

    • Validate binding modes using co-crystallization or NMR studies with recombinant protein

  • Species-Selective Inhibitor Development:

    • Compare AtpE sequences across pathogenic and non-pathogenic species to identify unique features

    • Focus on structural differences that can be exploited for selective inhibition

    • Target binding sites that differ between human and bacterial ATP synthases

    • Screen compound libraries against recombinant AtpE from multiple species to assess selectivity

  • Resistance Mechanism Studies:

    • Generate resistant mutants in laboratory settings using recombinant expression systems

    • Characterize molecular mechanisms of resistance using structural and biochemical approaches

    • Design inhibitors that remain effective against common resistance mutations

    • Explore combination approaches targeting multiple sites simultaneously

  • Novel Screening Platforms:

    • Develop high-throughput screening systems using reconstituted AtpE

    • Create reporter assays linked to AtpE inhibition for faster compound evaluation

    • Establish cell-based phenotypic screens that correlate with AtpE targeting

The critical role of ATP synthase in bacterial bioenergetics makes AtpE an attractive antimicrobial target, particularly for organisms where energy metabolism cannot be easily bypassed. Research indicates that species-specific variations in ATP synthase structure can be exploited to develop selective inhibitors with reduced off-target effects .

What are the challenges and solutions in studying the interaction between AtpE and other subunits of the ATP synthase complex?

Studying AtpE interactions with other ATP synthase subunits presents several challenges due to the complexity of this multi-subunit membrane protein complex. Current approaches to address these challenges include:

The interaction between AtpE (c-subunit) and subunit a is particularly critical for proton translocation, as they directly cooperate in the proton pumping process that drives ATP synthesis . Understanding these interactions is essential for developing inhibitors that target specific interfaces rather than individual subunits.

How do differences in AtpE isoforms affect ATP synthase assembly and function across species?

ATP synthase subunit c exhibits significant variability across species and even within the same organism, leading to important functional and structural differences:

  • Isoform Diversity and Functional Specificity:

    • Mammals possess three isoforms (P1, P2, P3) that differ in their mitochondrial targeting peptides while maintaining identical mature peptides

    • These isoforms are functionally non-redundant, as silencing any single isoform results in ATP synthesis defects

    • The targeting peptides play unexpected roles beyond protein import, contributing to respiratory chain maintenance

    • Isoform P2 specifically affects cytochrome oxidase assembly and function

  • Cross-Species Variations in c-Ring Stoichiometry:

    • The number of c-subunits per ring varies between species (8-15 subunits)

    • This variation affects the bioenergetic efficiency of ATP synthesis (H+/ATP ratio)

    • Structural adaptations accommodate different c-subunit numbers while maintaining function

    • Species-specific interactions with other ATP synthase subunits

  • Experimental Approaches to Study Isoform Differences:

    • RNA interference to selectively knockdown specific isoforms

    • Expression of targeting peptides fused to reporter proteins to study their specific functions

    • Cross-complementation experiments between isoforms to map functional domains

    • Comparative structural analysis of c-rings from different species

  • Evolutionary Implications:

    • Conservation of key functional residues across diverse species

    • Adaptation of c-subunit properties to different environmental conditions

    • Co-evolution with interacting subunits and assembly factors

These findings demonstrate that AtpE variants serve non-redundant roles through mechanisms that extend beyond their primary function in ATP synthesis, highlighting the complex regulatory networks governing mitochondrial energy metabolism .

What strategies can overcome low expression yields of recombinant AtpE?

Low expression yields of recombinant AtpE are a common challenge due to its hydrophobic nature and potential toxicity to host cells. Researchers can implement the following strategies to improve yields:

  • Expression System Optimization:

    • Use specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

    • Implement tightly regulated expression systems (e.g., pBAD, Tet-inducible) to minimize leaky expression

    • Consider alternative hosts like Lactococcus lactis or Bacillus subtilis that better tolerate membrane protein overexpression

    • Explore cell-free expression systems that bypass toxicity issues

  • Fusion Protein Approaches:

    • N-terminal fusions with highly soluble partners (MBP, GST, SUMO)

    • C-terminal GFP fusion to monitor expression and folding in real-time

    • Inclusion of solubilizing tags with specific cleavage sites for tag removal

  • Expression Condition Optimization:

    • Low-temperature expression (16-20°C) following induction

    • Reduced inducer concentration (20 μM IPTG rather than 0.5-1 mM)

    • Addition of specific chemical chaperones to culture media (glycerol, trehalose)

    • Cold shock treatment before induction (30 minutes on ice)

    • Supplementation with membrane components or specific lipids

  • Genetic Strategies:

    • Codon optimization for expression host

    • Co-expression with specific chaperones

    • Removal of rare codons or secondary structure in the mRNA

    • Introduction of stabilizing mutations

Optimization StrategyTypical Yield ImprovementImplementation Complexity
Specialized E. coli Strains2-5×Low
Fusion Proteins3-10×Moderate
Low Temperature Expression2-3×Low
Cold Shock Treatment1.5-2×Low
Codon Optimization2-4×Moderate
Cell-Free Expression1-3×High

The most effective approach often involves combining multiple strategies tailored to the specific properties of Sorangium cellulosum AtpE .

How can aggregation and instability of purified AtpE be prevented?

Aggregation and instability of purified AtpE pose significant challenges for structural and functional studies. Implementing the following strategies can enhance stability:

  • Optimized Detergent Selection:

    • Screen multiple detergent classes (maltosides, glucosides, neopentyl glycols)

    • Test detergent mixtures for synergistic stabilization

    • Determine critical micelle concentration (CMC) and maintain detergent above CMC

    • Consider detergent exchange during purification to optimize stability

  • Buffer Optimization:

    • Screen pH ranges to identify optimal stability conditions

    • Test various ionic strengths to minimize aggregation

    • Include stabilizing additives (glycerol 10-20%, sucrose, arginine)

    • Add specific lipids that interact with AtpE (cardiolipin, phosphatidylglycerol)

  • Thermal Stability Screening:

    • Perform thermal shift assays to identify stabilizing conditions

    • Monitor temperature-dependent aggregation using dynamic light scattering

    • Identify buffer conditions that maximize thermal stability

  • Covalent Modifications:

    • Site-specific crosslinking to stabilize oligomeric forms

    • Surface engineering to reduce aggregation-prone regions

    • Strategic disulfide bond introduction to enhance stability

  • Storage and Handling Protocols:

    • Flash-freeze samples in liquid nitrogen rather than slow freezing

    • Store at high protein concentration with subsequent dilution before use

    • Avoid repeated freeze-thaw cycles

    • Use continuous-flow dialysis for buffer exchange rather than dilution methods

  • Alternative Solubilization Approaches:

    • Amphipols for detergent-free membrane protein stabilization

    • Nanodiscs for lipid bilayer reconstitution

    • Styrene maleic acid lipid particles (SMALPs) for native membrane extraction

Stability assessment methods include size-exclusion chromatography to monitor oligomeric state, dynamic light scattering to detect aggregation, and functional assays to confirm retention of activity under various storage conditions .

What quality control methods ensure proper folding and oligomeric assembly of recombinant AtpE?

Ensuring proper folding and oligomeric assembly of recombinant AtpE requires rigorous quality control methods at multiple stages:

  • Biophysical Characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to monitor tertiary structure (intrinsic or using specific dyes)

    • Dynamic light scattering (DLS) to evaluate size distribution and aggregation state

    • Analytical ultracentrifugation to determine oligomeric state and homogeneity

  • Structural Integrity Assessment:

    • Limited proteolysis to probe correct folding (properly folded proteins show resistance to digestion)

    • Thermal stability assays (differential scanning fluorimetry) to monitor unfolding transitions

    • Native mass spectrometry to determine accurate oligomeric state and composition

    • Small-angle X-ray scattering (SAXS) for low-resolution structural validation

  • Functional Validation:

    • Proton translocation assays using reconstituted proteoliposomes

    • Inhibitor binding studies compared to native protein

    • ATP synthesis activity when reconstituted with other ATP synthase components

    • Patch clamp electrophysiology to verify ion channel properties

  • Oligomeric Assembly Verification:

    • Blue Native PAGE to analyze intact oligomeric complexes

    • Crosslinking followed by SDS-PAGE to capture interactions

    • Negative-stain electron microscopy to visualize c-ring formation

    • FRET-based assays to monitor subunit-subunit interactions

  • Benchmark Comparisons:

    • Side-by-side analysis with native AtpE isolated from Sorangium cellulosum

    • Comparison with well-characterized c-subunits from model organisms

    • Validation against published functional parameters

Each method provides complementary information, and applying multiple approaches ensures comprehensive quality control of recombinant AtpE preparations before proceeding to detailed structural and functional studies .

How might synthetic biology approaches enhance or modify AtpE function for biotechnological applications?

Synthetic biology offers promising approaches to engineer AtpE for enhanced properties and novel applications:

  • Engineered Energy Efficiency:

    • Modify c-ring stoichiometry to alter the H+/ATP ratio

    • Engineer ATP synthases with improved catalytic efficiency

    • Create variants that function under extreme conditions (temperature, pH)

    • Develop hybrid systems combining features from different species

  • Biosensor Development:

    • Engineer AtpE-based sensors for detecting membrane potential changes

    • Create systems that respond to specific environmental signals

    • Develop real-time ATP production monitoring systems

    • Design whole-cell biosensors using ATP synthase readouts

  • Biofuel Cell Applications:

    • Immobilize engineered ATP synthase on electrodes

    • Develop artificial systems that convert electrical energy to chemical energy

    • Create bio-hybrid devices for energy conversion

    • Engineer interfaces between biological ATP production and synthetic systems

  • Drug Delivery Systems:

    • Create engineered vesicles with controllable ATP-driven transport

    • Develop ATP-powered nanomachines for targeted delivery

    • Design responsive membranes with regulated permeability

  • Methodological Innovations:

    • Directed evolution approaches to enhance specific properties

    • Computational design of novel functions

    • Non-natural amino acid incorporation for enhanced stability or function

    • Development of minimal ATP synthase systems with reduced complexity

These approaches could enable development of more efficient bioenergetic systems, novel biosensors, and bio-inspired devices that harness the remarkable properties of this molecular machine for technological applications .

What are the most promising research frontiers in understanding the structural dynamics of AtpE during catalysis?

Understanding the structural dynamics of AtpE during catalysis represents a frontier in bioenergetics research, with several promising approaches:

  • Time-Resolved Structural Methods:

    • Time-resolved cryo-EM to capture transient conformational states

    • Serial crystallography at X-ray free-electron lasers (XFELs) for structural snapshots

    • Single-particle fluorescence resonance energy transfer (smFRET) to track subunit movements

    • High-speed atomic force microscopy to visualize conformational changes in real-time

  • Advanced Computational Approaches:

    • Molecular dynamics simulations across multiple timescales

    • Coarse-grained modeling of the entire ATP synthase complex

    • Quantum mechanical calculations of proton transfer events

    • Machine learning approaches to predict conformational transitions

  • Novel Spectroscopic Techniques:

    • Site-specific vibrational spectroscopy to monitor local environment changes

    • EPR spectroscopy with spin labels at key positions

    • NMR methods to capture dynamics in membrane environments

    • Mass spectrometry approaches to track hydrogen/deuterium exchange during function

  • Integrated Multi-Scale Analysis:

    • Combining structural, spectroscopic, and computational approaches

    • Correlating atomic-level changes with macroscopic function

    • Developing mathematical models linking structure to catalysis

    • Single-molecule studies correlated with ensemble measurements

These research directions aim to resolve the fundamental question of how proton translocation through the c-ring is mechanically coupled to ATP synthesis, with implications for understanding bioenergetic mechanisms across all domains of life and developing novel therapeutic approaches targeting this essential process .

How might comparing AtpE across different species contribute to our understanding of bioenergetic evolution?

Comparative analysis of ATP synthase subunit c across diverse species provides unique insights into the evolution of bioenergetic systems:

  • Evolutionary Conservation and Divergence:

    • Identify universally conserved residues essential for function

    • Map lineage-specific adaptations in different environmental niches

    • Trace the evolutionary history of c-ring stoichiometry variations

    • Analyze co-evolution patterns between AtpE and interacting subunits

  • Adaptation to Environmental Extremes:

    • Compare AtpE sequences from extremophiles (thermophiles, acidophiles, alkaliphiles)

    • Identify structural adaptations enabling function under extreme conditions

    • Engineer chimeric proteins combining features from different species

    • Develop predictive models for environment-specific adaptations

  • Methodological Approaches:

    • Phylogenetic analysis across all domains of life

    • Ancestral sequence reconstruction to investigate evolutionary trajectories

    • Structural comparison of c-rings from diverse organisms

    • Functional characterization of reconstructed ancestral proteins

  • Implications for Understanding Fundamental Principles:

    • Insight into the minimal requirements for ATP synthesis

    • Understanding convergent evolution in bioenergetic systems

    • Tracing the early evolution of chemiosmotic energy coupling

    • Identifying evolutionary constraints on ATP synthase function

  • Applications of Evolutionary Insights:

    • Rational design of AtpE variants with novel properties

    • Development of species-specific inhibitors based on divergent features

    • Engineering bioenergetic systems with optimized efficiency

    • Creating hybrid systems combining features from different evolutionary lineages

The non-redundant functions of mammalian ATP synthase subunit c isoforms, which differ only in their targeting peptides, illustrate how seemingly minor differences can confer distinct functional properties that are maintained through evolutionary pressure , suggesting complex regulatory mechanisms that may be revealed through comparative analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.