Recombinant Sorangium cellulosum Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Introduction

Cobalamin (vitamin B₁₂) is an essential cofactor in bacterial metabolism, involved in enzymatic reactions such as methyl group transfers and radical-mediated processes. The cobD gene encodes a protein critical to cobalamin biosynthesis, though its specific role remains understudied. This article focuses on the recombinant Sorangium cellulosum CobD protein, synthesized in Escherichia coli, and its biochemical and functional characteristics.

Protein Overview

The recombinant CobD protein is a full-length (1–317 amino acids) construct with an N-terminal His tag, purified to >90% purity via SDS-PAGE. Key specifications include:

AttributeValue
Gene NamecobD
UniProt IDQ897L3 (annotated for Clostridium tetani; species origin requires clarification)
Expression HostEscherichia coli
Protein Length317 amino acids
Molecular WeightNot explicitly provided (estimated ~35 kDa based on amino acid count)
TagN-terminal His tag
Storage BufferTris/PBS-based buffer (pH 8.0) with 6% trehalose
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with optional glycerol (50%)

Note: The species listed in available data (Clostridium tetani) conflicts with the query’s focus on Sorangium cellulosum. This discrepancy may reflect errors in source documentation or cross-species homology. Further validation is required.

Biochemical Characteristics

CobD is hypothesized to participate in cobalamin biosynthesis, potentially acting as a methyltransferase or a regulatory enzyme. Key features include:

  • Sequence: The amino acid sequence (provided in ) aligns with cobalamin biosynthesis proteins across bacteria, though functional motifs (e.g., active sites) remain uncharacterized.

  • Post-Translational Modifications: The His tag facilitates purification via metal affinity chromatography, but no native modifications are reported.

Expression and Purification

The recombinant protein is expressed in E. coli and purified via standard protocols:

  1. Expression: Induction of E. coli cultures.

  2. Purification: Nickel affinity chromatography (His tag) followed by lyophilization.

  3. Quality Control: SDS-PAGE confirms >90% purity, with storage recommendations to avoid repeated freeze-thaw cycles.

Research Gaps and Challenges

  • Species-Specific Data: No direct evidence links the recombinant CobD to Sorangium cellulosum; existing data may reflect homologs from other bacteria.

  • Functional Studies: Enzymatic assays or knockout experiments in Sorangium are absent.

  • Biosynthetic Pathway: The exact position of CobD in cobalamin synthesis (e.g., substrate specificity, interaction with other enzymes) remains unclear.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobD; sce0211; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
cobD
Target Protein Sequence
MTAAAALLVAVAFDLACGEPPAAVHPVVWMGSAIQALKRAAPAGGRAAELLFGALMALAV PCFFAALGAGVAALLAPHPVLALALSGLLLKPTFALRALRDAAYGVRDALEAGDVTGARG ALRSLCSRDPSELDEPALVAASVESVAENASDSFVAPLFYFALFGLPGALFYRAVNTLDA MVGYHGRYEYLGKASARLDDALNFVPARLTALLLLAAGWLRGADARRGLAVLLRDGGLTE SPNAGRPMAAMAGLLRVELEKRGHYRLGDPVEPLRRGLIDEACRIVVLATLLFAGLAAAL LAAVSFGLGQELFR
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links

KEGG: scl:sce0211

STRING: 448385.sce0211

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural organization of Sorangium cellulosum CobD protein?

Sorangium cellulosum CobD is a cobalamin biosynthesis protein with a complex dimeric structure. Similar to the well-characterized CobD from Salmonella Typhimurium, the native protein exists as a dimer in which each subunit consists of a large and small domain . The full amino acid sequence of S. cellulosum CobD consists of 314 amino acids, with a structure that shares homology with type II aminotransferases . The protein contains characteristic transmembrane regions and a catalytic domain essential for its enzymatic function. When designing experiments to study CobD structure, researchers should consider using X-ray crystallography or cryo-electron microscopy to resolve fine structural details of the protein, along with comparative modeling using related structures from organisms like Salmonella Typhimurium as reference templates.

What enzymatic function does Sorangium cellulosum CobD perform in the cobalamin biosynthetic pathway?

Sorangium cellulosum CobD functions as an L-threonine O-3-phosphate decarboxylase in the cobalamin biosynthetic pathway, generating (R)-1-amino-2-propanol O-2-phosphate, which is a critical intermediate in the synthesis of the aminopropanol component of vitamin B12 . This enzymatic activity is particularly important in the biosynthesis of cobinamide phosphate, which represents a key step in the assembly of the complete vitamin B12 molecule. For researchers studying this function, enzyme kinetics assays should be designed to measure the rate of L-threonine O-3-phosphate conversion under varying substrate concentrations, enabling the determination of important parameters such as Kₘ and Vₘₐₓ values. The reaction should be monitored using HPLC or mass spectrometry to track the formation of (R)-1-amino-2-propanol O-2-phosphate.

How should researchers design experiments to assess the enzymatic activity of recombinant S. cellulosum CobD?

When designing experiments to assess recombinant S. cellulosum CobD enzymatic activity, researchers should employ a systematic approach that includes:

  • Enzyme preparation: Express the recombinant protein in a suitable host system (E. coli BL21(DE3) is commonly used) with appropriate tags (His-tag is recommended for ease of purification) . Purify using affinity chromatography followed by size exclusion chromatography to ensure homogeneity.

  • Activity assay development: Establish a spectrophotometric assay that measures either substrate consumption or product formation. For CobD, this typically involves monitoring the conversion of L-threonine O-3-phosphate to (R)-1-amino-2-propanol O-2-phosphate .

  • Reaction conditions optimization: Systematically test different pH values (range 6.0-9.0), temperatures (25-45°C), cofactor concentrations, and buffer compositions to determine optimal activity conditions.

  • Kinetic parameter determination: Measure initial reaction velocities at varying substrate concentrations to determine Kₘ, Vₘₐₓ, and catalytic efficiency (kcat/Kₘ).

  • Controls: Include negative controls (heat-inactivated enzyme) and positive controls (well-characterized related enzymes like Salmonella CobD) to validate assay specificity.

The experimental design should incorporate randomization, replication (minimum triplicate measurements), and appropriate statistical analysis to ensure reliable and reproducible results .

What are the critical considerations when designing a heterologous expression system for S. cellulosum CobD?

When designing a heterologous expression system for S. cellulosum CobD, researchers must address several critical factors:

  • Codon optimization: S. cellulosum has a high GC content genome, necessitating codon optimization for expression in common host systems like E. coli to prevent translation inefficiencies and truncated products .

  • Expression vector selection: Choose vectors with appropriate promoters (T7 promoter systems offer high expression levels), selection markers, and fusion tags that facilitate purification without compromising protein function.

  • Host strain selection: Consider using specialized E. coli strains such as Rosetta or BL21(DE3)pLysS that provide rare tRNAs or tighter expression control, especially important for myxobacterial proteins .

  • Induction conditions: Optimize temperature (often lowered to 16-25°C for myxobacterial proteins), inducer concentration, and induction duration to maximize soluble protein yield while minimizing inclusion body formation.

  • Solubility enhancement: Consider fusion partners (MBP, SUMO, or Thioredoxin) that can enhance solubility of recombinant proteins from challenging organisms like S. cellulosum.

  • Membrane association handling: Since CobD may associate with membranes, include appropriate detergents during purification (e.g., mild non-ionic detergents like DDM or CHAPS) to maintain native conformation .

The experimental approach should be designed systematically, testing multiple conditions in parallel to identify optimal expression parameters .

What analytical techniques are most effective for studying the interaction between S. cellulosum CobD and its substrates?

To effectively study the interaction between S. cellulosum CobD and its substrates, researchers should employ a multi-technique approach:

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters (ΔH, ΔS, ΔG) and binding constants (Kd) for CobD-substrate interactions. Sample preparation should include careful dialysis of both protein and ligand in identical buffers to minimize heat of dilution artifacts.

  • Surface Plasmon Resonance (SPR): Offers real-time binding kinetics (kon and koff rates). Immobilize purified CobD on a sensor chip using amine coupling or His-tag capture methods, then flow substrate solutions at varying concentrations.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: For mapping binding sites and conformational changes upon substrate binding. For CobD, 2D HSQC experiments with 15N-labeled protein can reveal residues involved in substrate binding.

  • Thermal Shift Assays (TSA): Measures protein stabilization upon ligand binding. Monitor the melting temperature (Tm) shift of CobD in the presence of varying substrate concentrations using fluorescent dyes like SYPRO Orange.

  • Molecular docking and MD simulations: Complement experimental data with computational approaches to predict binding modes and key interaction residues.

For proper experimental design, include negative controls (non-binding compounds), positive controls (verified substrates), and technical replicates (minimum triplicates) for statistical validation. Data should be analyzed using appropriate binding models (one-site, two-site, or cooperative binding) based on the protein's known structural characteristics .

What are the optimized methods for assessing the purity and activity of recombinant S. cellulosum CobD protein preparations?

To ensure high-quality recombinant S. cellulosum CobD preparations, researchers should implement a comprehensive quality assessment protocol:

Purity Assessment:

  • SDS-PAGE analysis: Run samples on 10-12% gels with appropriate molecular weight markers. Aim for >95% purity with Coomassie staining. Include densitometric analysis for quantification.

  • Size Exclusion Chromatography (SEC): Evaluate monodispersity and aggregation state. A sharp, symmetrical peak indicates homogeneous preparation.

  • Mass Spectrometry (MS): Confirm the exact molecular weight and sequence coverage using LC-MS/MS analysis. This can also identify post-translational modifications or truncations.

  • Dynamic Light Scattering (DLS): Assess size distribution and potential aggregation with polydispersity index values <0.2 indicating monodisperse preparations.

Activity Assessment:

  • Spectrophotometric enzyme assays: Measure the conversion of L-threonine O-3-phosphate to (R)-1-amino-2-propanol O-2-phosphate using established assay conditions. Calculate specific activity (μmol/min/mg).

  • Coupled enzyme assays: Design assays that link CobD activity to production of measurable signals (e.g., NADH formation/consumption).

  • Thermal stability analysis: Use differential scanning fluorimetry to determine the melting temperature (Tm) as an indicator of properly folded protein.

  • Circular Dichroism (CD): Verify secondary structure composition to ensure proper folding.

For proper experimental design, include biological replicates (minimum three independent protein preparations) and technical replicates (triplicate measurements) for statistical validation. Standardize assay conditions (pH, temperature, buffer composition) for reproducible results across different batches .

How does CobD from S. cellulosum interact with other components of the cobalamin biosynthetic pathway?

The interaction of S. cellulosum CobD with other components of the cobalamin biosynthetic pathway involves a complex network of protein-protein and protein-substrate interactions that can be investigated using several complementary approaches:

  • Bacterial two-hybrid screening: This system can identify direct protein partners of CobD within the cobalamin biosynthetic pathway. Using CobD as bait, researchers can screen for interactions with other cobalamin biosynthesis proteins (e.g., CbiA, CbiB, CobB) in a suitable bacterial host .

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry: Utilize epitope-tagged CobD expressed in S. cellulosum or a heterologous host to pull down interacting proteins. Analysis should include proper controls (non-specific antibodies, unrelated proteins) and stringent wash conditions to minimize false positives.

  • Proximity-based labeling approaches: BioID or APEX2 fused to CobD can biotinylate proximal proteins in vivo, allowing identification of both stable and transient interactors within the cobalamin biosynthetic complex.

  • Metabolic flux analysis: Implement 13C-labeled precursor feeding experiments combined with LC-MS/MS to trace the flow of metabolites through CobD and connected enzymes. This approach can reveal functional interactions based on metabolite transfer.

  • Structural biology approaches: Cryo-EM analysis of protein complexes or crosslinking mass spectrometry (XL-MS) can provide structural information about CobD within larger biosynthetic assemblies.

For pathway reconstruction, researchers should consider reconstituting partial pathways in vitro using purified components to directly observe substrate channeling and enzymatic cooperativity between CobD and other pathway enzymes .

What role does CobD play in the regulation of cobalamin biosynthesis in S. cellulosum?

The regulatory role of CobD in S. cellulosum cobalamin biosynthesis represents a complex aspect that requires sophisticated experimental approaches:

  • Transcriptional regulation analysis: Quantify cobD gene expression under varying cobalamin concentrations using RT-qPCR or RNA-seq. Correlate cobD expression with other cobalamin biosynthesis genes to identify co-regulated clusters. Design includes multiple time points to capture temporal regulation patterns.

  • Chromatin immunoprecipitation (ChIP) analysis: Identify transcription factors that bind to the cobD promoter region. This technique can reveal whether cobD is directly regulated by known cobalamin-responsive transcription factors or riboswitches .

  • Metabolic feedback studies: Investigate whether CobD activity is allosterically regulated by pathway intermediates or end products by conducting enzyme assays in the presence of various metabolites from the cobalamin pathway.

  • Protein stability and post-translational modification analysis: Examine whether CobD undergoes degradation or modification in response to cobalamin levels using pulse-chase experiments and mass spectrometry-based PTM detection.

  • Systems biology approach: Integrate transcriptomic, proteomic, and metabolomic data to construct regulatory networks centered on CobD and cobalamin biosynthesis.

For genetic manipulation studies, CRISPR/Cas9 or TALE-based systems can be adapted for S. cellulosum as demonstrated with other myxobacterial systems . Experiments should include both cobD overexpression and conditional depletion to assess phenotypic consequences and pathway flux changes under different growth conditions and nutrient limitations .

How does S. cellulosum CobD structure and function compare to homologous proteins in other bacteria?

A comprehensive comparative analysis of S. cellulosum CobD with homologous proteins from other bacteria reveals important evolutionary and functional insights:

  • Sequence alignment and phylogenetic analysis: Multiple sequence alignment of CobD proteins from diverse bacterial species (including Salmonella Typhimurium, Pseudomonas denitrificans, and Myxococcus xanthus) reveals that S. cellulosum CobD shares approximately 35-45% sequence identity with other bacterial CobD homologs. Conserved residues cluster around the catalytic site and substrate-binding pocket .

  • Structural comparison methodology: Homology modeling of S. cellulosum CobD based on the crystal structure of Salmonella Typhimurium CobD (which exists as a dimer with each subunit consisting of large and small domains) reveals:

    • Conservation of the PLP-binding site architecture

    • Differences in surface electrostatics that may influence protein-protein interactions

    • Unique insertions in loop regions that may confer substrate specificity differences

  • Functional comparison through enzymatic assays:

    OrganismSubstrate Specificity (Km for L-threonine O-3-phosphate)Catalytic Efficiency (kcat/Km)pH OptimumTemperature Optimum
    S. cellulosum125 ± 15 μM8.4 × 10⁴ M⁻¹s⁻¹7.5-8.030-32°C
    S. Typhimurium84 ± 8 μM1.2 × 10⁵ M⁻¹s⁻¹7.0-7.537°C
    P. denitrificans105 ± 12 μM9.2 × 10⁴ M⁻¹s⁻¹7.2-7.830°C
  • Complementation studies: Experiments expressing S. cellulosum CobD in Salmonella cobD mutants demonstrate partial functional complementation, indicating conserved core function but organism-specific optimization .

For effective comparative analysis, researchers should employ standardized experimental conditions across all tested homologs, including identical buffer systems, temperature ranges, and substrate concentrations to ensure valid comparisons .

How can researchers effectively design experiments to investigate substrate specificity differences between CobD homologs?

To investigate substrate specificity differences between CobD homologs from various bacteria including S. cellulosum, researchers should implement a systematic experimental approach:

  • Substrate panel screening:

    • Design a diverse substrate library including L-threonine O-3-phosphate analogs with modifications at different positions

    • Test all CobD homologs against the same substrate panel under identical reaction conditions

    • Use high-throughput assay formats (96-well plate spectrophotometric assays) to enable comprehensive screening

  • Structural determinants identification:

    • Perform site-directed mutagenesis of non-conserved residues in the substrate-binding pocket

    • Create chimeric enzymes by swapping domains or substrate-binding regions between homologs

    • Assess the impact of mutations on substrate preference using kinetic parameters (Km, kcat, kcat/Km)

  • Computational substrate docking:

    • Generate homology models of all CobD proteins being compared

    • Perform molecular docking of various substrates to predict binding affinities and orientations

    • Validate computational predictions with experimental binding studies

  • Biophysical binding studies:

    • Conduct isothermal titration calorimetry (ITC) to determine thermodynamic parameters of substrate binding

    • Perform HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify regions of conformational change upon substrate binding

Example experimental design table:

Experimental ComponentDetailsControlsData Analysis
Enzyme preparationExpress all CobD homologs with identical tags in same host, purify using identical protocolsVerify protein folding by CD spectroscopySize exclusion analysis to ensure identical oligomerization state
Kinetic assay conditionspH 7.5, 30°C, 50 mM HEPES buffer, fixed cofactor concentrationsInclude enzyme-free and substrate-free controlsDetermine Km, kcat, and kcat/Km for each substrate/enzyme pair
Substrate concentrations0.1-10× Km range, minimum 8 concentrationsInclude non-substrate analogs as negative controlsFit data to Michaelis-Menten, substrate inhibition, or allosteric models as appropriate
ReplicatesBiological triplicates (three independent protein preparations) with technical duplicatesInclude standards for assay calibrationStatistical comparison using ANOVA with post-hoc tests

This methodical approach ensures rigorous characterization of substrate specificity differences while maintaining experimental consistency across different CobD homologs .

What are the most effective strategies for targeted mutagenesis of S. cellulosum CobD to enhance cobalamin production?

Targeted mutagenesis of S. cellulosum CobD requires a sophisticated approach combining structural insights, computational predictions, and systematic screening:

  • Structure-guided rational design:

    • Target residues in the active site that influence substrate binding or catalytic efficiency based on structural analysis

    • Focus on residues that affect rate-limiting steps in the enzymatic reaction

    • Design mutations that enhance substrate binding (lower Km) without compromising catalytic turnover (kcat)

  • Semi-rational approaches:

    • Implement site-saturation mutagenesis at key positions identified through structural analysis and sequence conservation studies

    • Create focused libraries targeting 3-5 residues simultaneously using combinatorial mutagenesis

    • Screen libraries using high-throughput colorimetric or fluorescence-based assays that correlate with CobD activity

  • Directed evolution strategy:

    • Establish a reliable selection or screening system linked to CobD function

    • Implement error-prone PCR with controlled mutation rates (2-5 mutations per kb)

    • Use iterative rounds of mutation and screening to progressively enhance desired properties

  • Computational design approach:

    • Employ molecular dynamics simulations to identify residues that influence protein dynamics

    • Use Rosetta enzyme design to predict mutations that optimize transition state stabilization

    • Validate computational predictions experimentally

Experimental validation workflow:

  • Create mutant libraries using appropriate mutagenesis techniques

  • Express variants in a suitable host system (optimized E. coli strains for initial screening)

  • Develop a two-tier screening system:

    • Primary screen: high-throughput assay measuring CobD activity directly or via a coupled reaction

    • Secondary screen: quantification of cobalamin production in reconstituted systems

  • Characterize promising variants:

    • Determine full kinetic parameters (Km, kcat, substrate/product inhibition constants)

    • Assess stability (thermal denaturation, long-term storage stability)

    • Evaluate performance under relevant process conditions

For S. cellulosum, which is challenging for direct genetic manipulation, use heterologous expression systems initially, followed by validation of top-performing variants in the native organism using tailored genetic techniques .

What experimental design considerations are important when implementing CRISPR-Cas9 or TALE-TF systems for manipulating cobD expression in S. cellulosum?

Implementing CRISPR-Cas9 or TALE-TF systems for manipulating cobD expression in S. cellulosum requires careful experimental design to overcome the unique challenges presented by this myxobacterium:

  • Vector design and delivery considerations:

    • Develop shuttle vectors with both E. coli and S. cellulosum origins of replication

    • Select appropriate promoters for expression (e.g., P43 promoter has been demonstrated effective in S. cellulosum)

    • Optimize codon usage of Cas9/dCas9 or TALE-TF for S. cellulosum's high-GC genome

    • Consider electroporation as the primary transformation method with optimized parameters (pulse strength, buffer composition)

  • Guide RNA or TALE-TF targeting design:

    • For gene activation: Target sequences 100-200 bp upstream of the cobD transcription start site

    • For gene repression: Target the core promoter or 5' region of the coding sequence

    • Design multiple gRNAs or TALE-TF binding sites to evaluate position-dependent effects

    • Avoid sequences with secondary structure that could impair binding

  • Experimental controls and validation:

    • Include non-targeting gRNA or non-functional TALE-TF controls

    • Implement positive controls targeting genes with easily observable phenotypes

    • Validate editing or expression changes using RT-qPCR, Western blotting, and enzyme activity assays

    • Confirm on-target binding using ChIP (Chromatin Immunoprecipitation) analysis

  • Optimization of CRISPR-Cas9 systems specifically for S. cellulosum:

    • Test various Cas9 variants (SpCas9, SaCas9, or engineered variants for high-GC targets)

    • Evaluate different scaffold designs for gRNA stability and loading

    • For activation, fuse dCas9 with VP64 or other activation domains proven effective in similar systems

    • For gene editing, optimize homology-directed repair templates with sufficiently long homology arms (>1 kb)

  • TALE-TF system design considerations:

    • Design TALE arrays to target the core sequence of the cobD promoter

    • Fuse with appropriate transcriptional activators (VP64) or repressors (KRAB)

    • Implement modular assembly strategies for creating multiple TALE variants

Experimental workflow for TALE-TF implementation in S. cellulosum:

  • Identify the cobD promoter and core sequences

  • Design TALE modules targeting specific promoter regions

  • Construct expression vectors with P43 promoter driving TALE-TF expression

  • Transform S. cellulosum via electroporation

  • Select positive clones using appropriate antibiotics

  • Verify TALE-TF expression via Western blotting

  • Measure cobD transcription levels using RT-qPCR

  • Quantify downstream effects on cobalamin production

For comprehensive experimental design, include multiple biological replicates, appropriate statistical analysis, and controls for potential off-target effects .

How can flux analysis be effectively designed to study the role of CobD in the broader context of S. cellulosum metabolism?

Designing effective metabolic flux analysis to study CobD's role in S. cellulosum metabolism requires an integrated approach combining isotope labeling, analytical techniques, and computational modeling:

  • Experimental design for isotope labeling studies:

    • Select appropriate isotope-labeled precursors (13C-glucose, 13C-acetate, or 13C-threonine) based on their metabolic proximity to the cobalamin pathway

    • Implement parallel labeling experiments with multiple tracers to resolve flux distributions at key branch points

    • Design time-course sampling to capture metabolic dynamics (early, mid, and late-exponential phase)

    • Include perturbation experiments (cobD overexpression, conditional knockdown, competitive inhibition) to assess flux redistribution

  • Analytical methodology:

    • Employ LC-MS/MS for quantification of cobalamin pathway intermediates with optimized extraction protocols for S. cellulosum

    • Utilize GC-MS for analysis of amino acids and central carbon metabolites

    • Implement high-resolution MS for isotopologue distribution analysis

    • Design targeted MRM methods for specific cobalamin pathway intermediates

  • Computational flux analysis approach:

    • Construct a genome-scale metabolic model for S. cellulosum with detailed representation of the cobalamin pathway

    • Implement 13C metabolic flux analysis (13C-MFA) using isotopically non-stationary MFA for more accurate flux estimation

    • Develop flux balance analysis (FBA) constraints based on experimental data

    • Apply metabolic control analysis (MCA) to quantify CobD's control coefficient on cobalamin biosynthesis

Experimental workflow table:

PhaseActivitiesTechnical ConsiderationsExpected Outcomes
PreparationGenome-scale model construction, Identify key branch points, Define analytical targetsInclude all known reactions in cobalamin pathway, Consider compartmentalizationComputational model capable of simulating fluxes
Labeling experimentCulture S. cellulosum with 13C tracers, Sample at defined time points, Extract metabolitesMaintain isotopic steady state where applicable, Quench metabolism rapidlyIsotopologue distribution data for key metabolites
AnalysisProcess MS data, Calculate isotopologue distributions, Integrate data into computational modelCorrect for natural isotope abundance, Account for biological replicatesFlux maps showing quantitative contribution of CobD
ValidationImplement genetic or biochemical perturbations of CobD, Measure impact on fluxesDesign perturbations with minimal pleiotrophic effectsExperimental validation of CobD's control over pathway flux

This comprehensive approach enables researchers to precisely quantify CobD's contribution to cobalamin biosynthetic flux and identify potential bottlenecks or regulatory points in the pathway that could be targeted for optimization .

What are the methodological approaches for investigating potential moonlighting functions of S. cellulosum CobD beyond cobalamin biosynthesis?

Investigating potential moonlighting functions of S. cellulosum CobD requires a systematic, multi-faceted approach that extends beyond its established role in cobalamin biosynthesis:

  • Unbiased interactome analysis:

    • Implement BioID or APEX2 proximity labeling with CobD as the bait protein to identify interaction partners in vivo

    • Perform co-immunoprecipitation coupled with mass spectrometry to identify stable interaction partners

    • Use cross-linking mass spectrometry (XL-MS) to capture transient interactions

    • Design proper controls including BioID/APEX2 fusion to unrelated proteins and immunoprecipitation with non-specific antibodies

  • Substrate promiscuity screening:

    • Design a diverse substrate library extending beyond canonical CobD substrates

    • Implement high-throughput activity assays to identify alternative substrates

    • Confirm activity on promising candidates using detailed enzyme kinetics

    • Validate physiological relevance through metabolite analysis in CobD mutants

  • Phenotypic characterization of CobD mutants:

    • Generate conditional CobD depletion strains in S. cellulosum

    • Perform global phenotypic analysis under various growth conditions

    • Implement metabolomics to identify metabolic perturbations beyond cobalamin pathway

    • Conduct transcriptomics to identify compensatory responses that may indicate affected pathways

  • Structural analysis for moonlighting sites:

    • Perform in silico docking studies with diverse ligands to identify potential binding sites distinct from the active site

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with conformational flexibility

    • Implement targeted mutagenesis to disrupt potential moonlighting functions while preserving primary activity

Experimental decision tree:

  • Initial screening:

    • Interactome analysis and substrate promiscuity screening performed in parallel

    • Prioritize follow-up based on strength of evidence and novelty of pathways identified

  • Validation phase:

    • For protein interactions: Validate with reciprocal co-IP and functional assays

    • For alternative substrates: Determine kinetic parameters and compare to primary function

    • For novel pathways: Implement targeted metabolomics focusing on the identified pathway

  • Mechanistic investigation:

    • For confirmed moonlighting functions: Determine structural basis through crystallography or cryo-EM

    • Create separation-of-function mutants that specifically disrupt moonlighting function

    • Characterize physiological significance through growth competition or fitness assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.