Recombinant Sorangium cellulosum Cobalt transport protein CbiM (cbiM)

What is the structure and function of Sorangium cellulosum Cobalt transport protein CbiM?

CbiM is a membrane substrate-binding component of the Energy-coupling factor (ECF) transporter in Sorangium cellulosum. The protein consists of 225 amino acids with a full sequence of MHLAEGVLPLGWCAFWNALALPFVAIALHLLRRRTEQDAFYKPFVGLIAAAVFAISCMPVPVPTAGTCSHPCGTGLAAVLIGPWMTVLVTVVALLIQALFLAHGGLTTLGADVASMGIAGAFTGYFAFHLARRSGANLWVAGFLAGVTSDWATYATTALALALGLSGEGSVTSMFTGVALAFVPTQLPLGLLEGVMTAGALAFLRARRPDILDRLQVVRLAPGAS .

Functionally, CbiM serves as the substrate-binding component (EcfS) within the CbiMNQO transporter complex, which is responsible for cobalt uptake across the cell membrane. The transport process requires conformational changes including rotation or toppling of both CbiQ and CbiM components, with CbiN potentially functioning in coupling these conformational changes .

How should recombinant CbiM protein be stored and handled for optimal stability?

Recombinant CbiM protein requires specific storage conditions to maintain stability and functionality:

• Storage temperature: -20°C for regular use; -80°C for extended storage periods

• Buffer composition: Typically stored in Tris-based buffer with 50% glycerol

• Aliquoting: Working aliquots should be stored at 4°C for up to one week

• Freeze-thaw cycles: Repeated freezing and thawing is not recommended

For reconstitution, the lyophilized protein should be briefly centrifuged prior to opening, then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for long-term storage .

What expression systems are most effective for producing recombinant Sorangium cellulosum CbiM protein?

E. coli expression systems have been successfully employed for the production of recombinant CbiM protein. The approach typically involves:

• Gene cloning: The cbiM gene (sce0249) is amplified from Sorangium cellulosum genomic DNA and inserted into an appropriate expression vector

• Expression optimization: Parameters such as temperature, inducer concentration, and duration must be optimized for maximal protein yield

• Purification strategy: His-tag affinity chromatography is commonly employed, similar to methods used for related proteins such as the Halobacterium salinarum CbiM

Importantly, recombinant vectors derived from broad-host-range mobilizable plasmids like pSUP2021 can be constructed and transferred by IncP-mediated conjugation from Escherichia coli to Sorangium cellulosum, where they integrate into the chromosome by homologous recombination and remain stably maintained .

What methodologies are optimal for studying the structure-function relationship of the CbiMNQO transporter complex?

Studying the structure-function relationship of the CbiMNQO complex requires a multi-faceted approach:

• Structural determination methods:

  • X-ray crystallography has been successfully employed to determine the structure of the CbiMQO complex in its inward-open conformation

  • Cryo-electron microscopy can provide insights into different conformational states during the transport cycle

• Functional analysis techniques:

  • Reconstitution of different CbiMNQO subunits to determine their contributions to transporter activity

  • ATPase activity assays to quantify the stimulatory effect of the substrate-binding subunit CbiM on CbiQO's basal ATPase activity

  • Transport assays using radiolabeled cobalt to measure transport kinetics in reconstituted systems

• Mutagenesis approaches:

  • Site-directed mutagenesis of key residues, particularly in the L1 loop of CbiM which has been identified as having a substrate-gating function

  • Truncation or domain swapping experiments to investigate the role of CbiN in coupling conformational changes between CbiQ and CbiM

How can genetic manipulation techniques be optimized for studying CbiM function in Sorangium cellulosum?

Genetic manipulation of Sorangium cellulosum presents unique challenges that require specialized approaches:

• Gene transfer optimization:

  • Recombinant vectors derived from broad-host-range mobilizable plasmids such as pSUP2021 can be transferred via IncP-mediated conjugation from E. coli to S. cellulosum

  • The vectors integrate into the chromosome by homologous recombination and maintain stable inheritance

• Conjugation efficiency improvement:

  • Dual selection antibiotics can significantly enhance conjugation efficacy in Sorangium cellulosum

  • Optimizing donor:recipient ratios and conjugation conditions (temperature, time, medium composition) can further improve transfer efficiency

• Expression validation methods:

  • Reporter genes such as green fluorescent protein (GFP) can be used to confirm successful transformation and expression

  • Autonomously replicating plasmids have been demonstrated to transform S. cellulosum So ce90 and induce expression of green fluorescent protein

• Gene knockout/knockdown strategies:

  • Homologous recombination-based gene replacement can be used to generate cbiM knockout strains

  • CRISPR-Cas9 systems adapted for S. cellulosum could potentially offer more efficient genome editing opportunities

What is known about the mechanism of cobalt transport through the CbiMNQO complex?

The CbiMNQO complex operates through a sophisticated ATP-dependent transport mechanism:

• Transport cycle components and their roles:

  • CbiM/CbiN: Corresponds to the EcfS component, responsible for substrate binding

  • CbiQ: Corresponds to the EcfT component, an integral membrane scaffold protein

  • CbiO: Corresponds to the EcfA component, responsible for ATP binding and hydrolysis

• Proposed transport mechanism:

  • The transport process requires rotation or toppling of both CbiQ and CbiM components

  • CbiN functions in coupling conformational changes between CbiQ and CbiM

  • ATP binding and hydrolysis by CbiO drives conformational changes in the complex

  • The L1 loop of CbiM serves as a substrate gate, controlling cobalt access to the transport pathway

• Conformational states:

  • The CbiMQO complex has been determined in its inward-open conformation

  • CbiO undergoes conformational changes induced by ATP binding (closed conformation) and product release within the complex

This mechanistic model suggests that the transport process involves an elevator-like movement of the substrate-binding domain, coupled to ATP hydrolysis in the cytoplasmic domains.

How does the CbiM protein from S. cellulosum compare to homologous proteins in other bacterial species?

Comparative analysis of CbiM proteins reveals important evolutionary and functional relationships:

• Structural conservation and divergence:

  • CbiM proteins across bacterial species share a core transmembrane architecture

  • The Halobacterium salinarum CbiM (220 aa) shows structural similarities to the S. cellulosum protein (225 aa), with conserved regions particularly in the substrate binding sites

• Sequence comparison and phylogeny:

  • The S. cellulosum genome shows evidence of gene duplication events, which may have contributed to the expansion and functional diversification of transport proteins

  • Some S. cellulosum genes like sce2351 and sce2855 potentially resulted from lateral gene transfer, suggesting horizontal acquisition of certain transport capabilities

• Functional domain organization:

  • The amino acid sequence of CbiM from S. cellulosum (MHLAEGVLPLGWCAFWNALALPFVAIALHLLRRRTEQDAFYKPFVGLIAAAVFAISCMPVPVPTAGTCSHPCGTGLAAVLIGPWMTVLVTVVALLIQALFLAHGGLTTLGADVASMGIAGAFTGYFAFHLARRSGANLWVAGFLAGVTSDWATYATTALALALGLSGEGSVTSMFTGVAL AFVPTQLPLGLLEGVMTAGALAFLRARRPDILDRLQVVRLAPGAS) contains transmembrane regions consistent with its membrane transport function

  • The H. salinarum CbiM shows a similar transmembrane organization: MHIMEGFLPGIWALVWFVVAIPVISYGALKTARLARNDELNKSHIAVAAAFIFVLSALKIPSVTGSTSHPTGTGIAVVLFGPAVTAFLSAIVLLYQALLLGHGGLTTLGANVVSMGVVGPVAGWVVFRALNPYLDLQKATFAAAVIADWTTYLVTSIQLGVAFPSGPGVAGVVDSIVRFASVFSITQIPIGIVEGALAAGLIGYIAMSRQSIKTRLGVTA

What are the most effective assays for measuring CbiM-mediated cobalt transport activity?

The following methodological approaches can be employed to quantify CbiM-mediated cobalt transport:

• In vitro reconstitution systems:

  • Purified CbiM components can be reconstituted into liposomes or nanodiscs

  • Different combinations of CbiMNQO subunits can be tested to determine the minimal functional unit and the contribution of each component

• ATPase activity assays:

  • Colorimetric assays measuring inorganic phosphate release can quantify the ATP hydrolysis rates

  • The stimulatory effect of the substrate-binding subunit CbiM on CbiQO's basal ATPase activity can be measured under various conditions (substrate concentration, pH, temperature)

• Transport assays:

  • Radioisotope (⁵⁷Co or ⁶⁰Co) uptake measurements in reconstituted systems

  • Fluorescent metal indicators can be encapsulated in liposomes to monitor cobalt influx in real-time

• Binding affinity measurements:

  • Isothermal titration calorimetry (ITC) to determine binding constants for cobalt

  • Surface plasmon resonance (SPR) to study the interaction kinetics between CbiM and cobalt ions

These methodological approaches provide complementary data on the transport properties of the CbiM protein and the complete CbiMNQO complex.

What are the critical factors in designing experiments to study CbiM function?

When investigating CbiM function, researchers should consider several experimental design factors:

• Expression system selection:

  • E. coli expression systems typically yield sufficient quantities of recombinant CbiM

  • For functional studies, co-expression of all components (CbiM, CbiN, CbiQ, CbiO) may be necessary to obtain a functional complex

• Protein purification strategy:

  • Membrane proteins like CbiM require detergent solubilization

  • Selection of appropriate detergents is critical for maintaining native structure and function

  • Affinity tags placement should minimize interference with function

• Metal contamination control:

  • Experiments must control for contaminating metals that may compete with cobalt

  • Chelating agents should be used cautiously as they may interfere with transport assays

• Genetic manipulation considerations:

  • When working with S. cellulosum directly, the efficiency of conjugation can be improved using dual selection antibiotics

  • Homologous recombination can be exploited for chromosomal integration of constructs

What protocols are recommended for the structural analysis of CbiM and the CbiMNQO complex?

Structural analysis of CbiM and the CbiMNQO complex can be performed using various techniques:

• X-ray crystallography:

  • Protein crystallization typically requires detergent-solubilized and highly purified protein

  • Lipidic cubic phase crystallization may be suitable for membrane proteins like CbiM

  • Structure determination of the CbiMQO complex in its inward-open conformation has been achieved using this approach

• Cryo-electron microscopy:

  • Particularly useful for capturing different conformational states of the transporter

  • Sample preparation involves vitrification of purified protein in detergent micelles or nanodiscs

• Biochemical mapping techniques:

  • Chemical cross-linking coupled with mass spectrometry to identify interacting domains

  • Limited proteolysis to define domain boundaries and flexible regions

  • Accessibility measurements using cysteine-scanning mutagenesis and thiol-reactive probes

• Computational modeling:

  • Homology modeling based on related structures

  • Molecular dynamics simulations to study conformational changes during the transport cycle

These approaches provide complementary structural information about CbiM and the complete CbiMNQO complex at different resolutions.