Recombinant Sorangium cellulosum NADH-quinone oxidoreductase subunit K (nuoK)

What is Sorangium cellulosum and why is it significant to researchers?

Sorangium cellulosum is a soil-dwelling Gram-negative bacterium belonging to the myxobacteria group. It possesses notable significance in research due to its unusually large genome (approximately 13,033,779 base pairs), making it the largest bacterial genome sequenced to date by roughly 4 Mb. The bacterium exhibits gliding motility and forms fruiting bodies under stressful conditions, with cells congregating and differentiating into myxospores. This social behavior makes isolation and colony counts challenging as colonies tend to merge on agar medium. S. cellulosum is particularly known for being a prolific producer of secondary metabolites with potential pharmaceutical applications, producing approximately 50% of all known metabolites from myxobacteria .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its function?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH dehydrogenase I complex, a critical enzyme in the electron transport chain. The complete protein consists of 103 amino acids with the sequence: MISVPIEYYLVVAAVLFLIGSIGFLLRRNLLVLLMSIELMLNAVNLTLVAYNRVHPHDHA GQIFTFFVIAIAAAEAAVGLAIVLAFYRIRKTMRSDDADLLRS. This protein participates in the transfer of electrons from NADH to quinones, contributing to the generation of a proton gradient across the membrane that drives ATP synthesis. As part of the respiratory complex I, nuoK plays a critical role in oxidative phosphorylation and energy metabolism in the bacterium .

How does the recombinant version of nuoK differ from the native protein?

The recombinant version of S. cellulosum nuoK is typically expressed with an N-terminal histidine tag to facilitate purification using affinity chromatography. This His-tagged version allows for efficient isolation through nickel nitrilotriacetate columns, where the protein can be eluted using imidazole under non-denaturing conditions. While the addition of the His-tag enables easier purification, researchers should be aware that it may potentially affect certain aspects of protein folding, activity, or interaction capabilities compared to the native form. Functional studies comparing the tagged and untagged versions are recommended when activity is critical for experimental outcomes .

What are the optimal conditions for heterologous expression of recombinant S. cellulosum nuoK?

For optimal heterologous expression of recombinant S. cellulosum nuoK, E. coli serves as the preferred expression system due to its well-established genetic tools and rapid growth characteristics. The optimal expression protocol involves:

• Cloning the nuoK gene into an appropriate expression vector containing a His-tag sequence

• Transforming the construct into an E. coli expression strain (commonly BL21(DE3) or derivatives)

• Growing cultures at 37°C to mid-log phase (OD600 of 0.6-0.8)

• Inducing protein expression with IPTG (0.1-1.0 mM) at reduced temperature (16-25°C) for 4-16 hours

• Harvesting cells by centrifugation and lysing through sonication or mechanical disruption

The reduced temperature during induction helps to minimize the formation of inclusion bodies and improves the yield of properly folded protein, particularly important for membrane-associated proteins like nuoK .

What purification strategy yields the highest purity of recombinant nuoK protein?

A multi-step purification strategy yields the highest purity of recombinant His-tagged nuoK protein:

• Initial clarification: Centrifugation of cell lysate (20,000 × g, 30 min) to remove cell debris

• Immobilized metal affinity chromatography (IMAC): Loading the clarified lysate onto a nickel nitrilotriacetate column

• Stepwise elution: Using an imidazole gradient (typically 20-300 mM) to separate the His-tagged nuoK from contaminants

• Size exclusion chromatography: Further purification based on molecular size to remove aggregates and improve homogeneity

• Validation: Confirming purity by SDS-PAGE and western blotting with anti-His antibodies

This approach routinely achieves greater than 90% purity as determined by SDS-PAGE, suitable for most biochemical and structural studies. For membrane proteins like nuoK, the addition of appropriate detergents during purification is essential to maintain protein solubility and native conformation .

How can researchers verify the correct folding and assembly of purified nuoK?

Verification of correct folding and assembly of purified nuoK requires multiple complementary methods:

• Circular dichroism (CD) spectroscopy: To analyze secondary structure content and confirm proper folding

• Size exclusion chromatography with multi-angle light scattering (SEC-MALS): To determine the oligomeric state and homogeneity

• Functional assays: Measuring NADH oxidation activity using quinone analogs as electron acceptors

• Thermal shift assays: To assess protein stability and the effects of buffer components

• Limited proteolysis: To probe the accessibility of proteolytic sites as an indicator of proper folding

When nuoK is intended to be studied as part of the complete NADH-quinone oxidoreductase complex, blue native PAGE can additionally be used to verify proper complex assembly. Proper verification of folding is particularly important for membrane proteins like nuoK, which may require specialized detergents or lipid environments to maintain their native conformation .

What are the recommended storage conditions for maintaining nuoK stability?

For optimal stability of recombinant S. cellulosum nuoK, the following storage conditions are recommended:

• Short-term storage (up to one week): Store working aliquots at 4°C in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

• Long-term storage: Store at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles

• Cryoprotection: Add 5-50% glycerol (final concentration) before freezing, with 50% being optimal for maximum stability

• Lyophilization option: For extended storage, lyophilized powder forms are stable when stored at -20°C

Before opening stored samples, briefly centrifuge vials to bring contents to the bottom. This is particularly important for lyophilized samples. Protein stability should be periodically verified for long-term storage using activity assays or structural analysis techniques .

What reconstitution protocol ensures optimal activity of lyophilized nuoK protein?

The optimal reconstitution protocol for lyophilized nuoK protein consists of:

• Initial preparation: Centrifuge the vial briefly to collect all material at the bottom before opening

• Reconstitution solution: Use deionized sterile water to prepare a 0.1-1.0 mg/mL protein solution

• Gentle handling: Avoid vigorous vortexing; instead, dissolve by gentle pipetting or rotation

• Stabilization: Add glycerol to a final concentration of 5-50% (optimally 50%) for stability

• Equilibration: Allow the reconstituted protein to stand at room temperature for 10-15 minutes before use

• Aliquoting: Divide into single-use aliquots to prevent repeated freeze-thaw cycles

• Activity verification: Perform a small-scale activity assay to confirm functional integrity

This protocol maintains protein structure and function while minimizing aggregation or denaturation. For membrane proteins like nuoK, addition of appropriate detergents may be necessary during reconstitution to maintain solubility .

How can researchers design experiments to study subunit interactions in NADH-quinone oxidoreductase complexes?

Designing experiments to study subunit interactions in NADH-quinone oxidoreductase complexes requires a multifaceted approach:

• Heterodimer expression strategy:

  • Express a wild-type/mutant heterodimer with differential tagging (e.g., His-tag on one subunit)

  • Purify using stepwise elution with imidazole from a nickel nitrilotriacetate column

  • Confirm heterodimer composition using SDS and non-denaturing PAGE, followed by immunoblot analysis

• Functional analysis:

  • Compare enzyme kinetics between homodimers and heterodimers

  • Test activity with different electron acceptors (two-electron vs. four-electron acceptors)

  • Analyze Km and kcat values to determine independence or dependence of subunit function

• Structural characterization:

  • Use crosslinking techniques to capture transient interactions

  • Employ hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

  • Utilize cryo-EM or X-ray crystallography for high-resolution structural determination

This approach has revealed that NADH-quinone oxidoreductase subunits can function independently with two-electron acceptors but dependently with four-electron acceptors, suggesting complex allosteric regulation between subunits .

What genetic manipulation techniques are most effective for studying nuoK function in S. cellulosum?

Genetic manipulation of S. cellulosum for studying nuoK function presents unique challenges due to the organism's complex lifecycle and large genome. The most effective techniques include:

• IncP-mediated conjugation:

  • Construct recombinant vectors derived from broad-host-range mobilizable plasmids (e.g., pSUP2021)

  • Transfer from E. coli to S. cellulosum via conjugation

  • Select for chromosomal integration by homologous recombination

  • Confirm stable maintenance through successive generations

• Dual antibiotic selection strategy:

  • Improve conjugation efficacy by incorporating dual selection antibiotics

  • Design constructs with multiple resistance markers to reduce false positives

• Site-directed mutagenesis:

  • Create specific amino acid substitutions in nuoK to probe structure-function relationships

  • Analyze effects on complex assembly and electron transfer activities

• Reporter gene fusion:

  • Fuse nuoK with fluorescent proteins (like GFP) to track localization and expression

  • Use autonomously replicating plasmids for expression studies

These techniques have successfully enabled genetic manipulation of S. cellulosum, opening possibilities for in-depth studies of nuoK function in its native cellular context .

How can researchers integrate nuoK functional studies with whole-genome analyses of S. cellulosum?

Integrating nuoK functional studies with whole-genome analyses of S. cellulosum requires a systems biology approach:

How should researchers analyze kinetic data from nuoK-containing enzyme complexes?

Analysis of kinetic data from nuoK-containing enzyme complexes requires sophisticated approaches to account for the complexity of multi-subunit enzymes:

• Steady-state kinetics analysis:

  • Determine Km and kcat values for different electron donors (NADH, NADPH) and acceptors

  • Compare parameters between wild-type, mutant, and heterodimeric complexes

  • Use non-linear regression to fit data to appropriate kinetic models (Michaelis-Menten, Hill, etc.)

• Pre-steady-state kinetics:

  • Employ stopped-flow spectroscopy to resolve rapid electron transfer events

  • Analyze reaction traces using exponential functions to extract rate constants

  • Develop kinetic models that incorporate all observed phases

• Statistical validation:

  • Apply appropriate statistical tests to determine significance of parameter differences

  • Calculate confidence intervals for all kinetic constants

  • Use replicates (minimum n=3) to ensure reproducibility

This analytical framework reveals that subunits of NADH-quinone oxidoreductase function independently with two-electron acceptors but dependently with four-electron acceptors, providing crucial insights into the complex mechanisms of electron transfer in this enzyme system .

What approaches are recommended for analyzing structure-function relationships in nuoK protein?

For analyzing structure-function relationships in nuoK protein, researchers should implement a comprehensive approach that combines computational prediction with experimental validation:

• Sequence-based analysis:

  • Multiple sequence alignment across diverse species to identify conserved residues

  • Hydrophobicity analysis to predict membrane-spanning regions

  • Identification of potential functional motifs using domain prediction tools

• Homology modeling and simulation:

  • Generate structural models based on homologous proteins with known structures

  • Molecular dynamics simulations to predict conformational changes

  • Docking studies to identify potential interaction sites with electron carriers

• Targeted mutagenesis strategy:

  • Design mutations based on conservation analysis and structural predictions

  • Focus on transmembrane residues and potential quinone-binding regions

  • Create a mutation matrix covering conserved and non-conserved positions

• Functional correlation:

  • Correlate activity changes with specific structural features

  • Map activity-altering mutations onto the 3D structure

  • Develop a mechanistic model explaining electron transfer pathways

This integrated approach has revealed that membrane-spanning regions of nuoK likely participate in forming the quinone-binding pocket, while highly conserved charged residues facilitate proton translocation coupled to electron transfer. The amino acid sequence of nuoK (MISVPIEYYLVVAAVLFLIGSIGFLLRRNLLVLLMSIELMLNAVNLTLVAYNRVHPHDHA GQIFTFFVIAIAAAEAAVGLAIVLAFYRIRKTMRSDDADLLRS) contains critical functional domains that can be mapped through these analyses .

How can researchers distinguish between direct and indirect effects when studying nuoK mutations?

Distinguishing between direct and indirect effects of nuoK mutations requires a comprehensive experimental approach:

This systematic approach enables researchers to distinguish between mutations that directly affect nuoK function and those that indirectly impact the NADH-quinone oxidoreductase complex through structural destabilization or disrupted protein-protein interactions .