Recombinant Sorangium cellulosum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its implementation.
Synonyms
kdpC; sce1354; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
kdpC
Target Protein Sequence
MLAHLRPALVLLLVLTGLTGFAYPLLSTAIAQAAFPHQAHGSLVRKDGRVVGSTLLGQPF DDPRYFWGRPSATSPVPYAGQASAGSNLGPTNPALAEAVKARVDALRAADPEGAAPVPVD LVTASGSGLDPHISPAGAEHQVRRVARARGLSEAEVRRFVARHTEGRLLGLLGEPHVNVL LLNLALDGAR
Uniprot No.

Target Background

Function

The Recombinant Sorangium cellulosum Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. This system catalyzes ATP hydrolysis, coupling it to the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATPase subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: scl:sce1354

STRING: 448385.sce1354

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Sorangium cellulosum and why is it significant in research?

Sorangium cellulosum is a soil-dwelling Gram-negative bacterium belonging to the myxobacteria group. It is particularly noteworthy in microbiology research due to its exceptionally large genome, measured at 13,033,779 base pairs, making it the largest bacterial genome sequenced to date by approximately 4 Mb. This organism demonstrates gliding motility and forms fruiting bodies under stressful conditions, where cells congregate and differentiate into myxospores. The bacterium is commonly found in soils, animal feces, and tree bark, functioning as a saprophyte that aerobically metabolizes cellulose for nutrition. Importantly, S. cellulosum is a prolific producer of secondary compounds, generating approximately 50% of all known metabolites produced by myxobacteria, which has prompted extensive exploration of its genome for potential medical and industrial applications .

What is the KdpFABC complex and what specific role does KdpC play within this system?

The KdpFABC is an oligomeric potassium transport complex in prokaryotes that maintains ionic homeostasis under potassium-limiting stress conditions. This complex represents a fascinating hybrid system comprising a channel-like subunit (KdpA) from the superfamily of K+ transporters and a pump-like subunit (KdpB) from the P-type ATPase superfamily. Within this complex, KdpC functions as a critical stabilizing component that remains static during the conformational changes that occur during the transport cycle. Its structural stability provides an essential anchoring function while KdpB undergoes the ATP-dependent conformational changes typical of P-type ATPases. KdpC appears to facilitate the coupling between ATP hydrolysis in KdpB and the movement of potassium ions through the complex, ultimately enabling the maintenance of intracellular potassium levels under stress conditions .

How is the amino acid sequence of KdpC organized and what are its key structural features?

The Potassium-transporting ATPase C chain (kdpC) from Sorangium cellulosum consists of 190 amino acids with a specific sequence that begins with mLAHLRPALVLLLVLTGLTGFAYPLLSTAIAQAAFPHQAHGSLVRKDGRVVGSTLLGQPF and continues through the protein. The protein contains several hydrophobic regions consistent with its membrane-associated function. The N-terminal region appears to contain a signal sequence typical of membrane proteins, while the central and C-terminal portions likely interact with other subunits of the KdpFABC complex. The protein's official EC number is 3.6.3.12, classifying it as an ATP phosphohydrolase involved in potassium transport. Alternative names include "ATP phosphohydrolase [potassium-transporting] C chain," "Potassium-binding and translocating subunit C," and "Potassium-translocating ATPase C chain," reflecting its role in potassium transport mechanisms .

How does the structure of KdpFABC change during the potassium transport cycle?

Cryo-electron microscopy studies have revealed that during the potassium transport cycle, KdpFABC adopts multiple conformational states that correspond to different enzymatic intermediates. Remarkably, while KdpB undergoes significant conformational changes consistent with other P-type ATPases, the KdpA, KdpC, and KdpF subunits remain relatively static throughout the cycle. These structural studies have identified four key intermediates in the reaction cycle: the E1 state (unliganded), the E1·ATP state (with bound ATP analog), the E2-P state (prehydrolysis), and the E2·Pi state (posthydrolysis).

The transition between these states involves significant rearrangements in KdpB, particularly in the positioning of its cytoplasmic domains (N-domain, P-domain, and A-domain) relative to the membrane domain. For example, in the transition from E2-P to E2·Pi, the cytoplasmic extension of the M2 transmembrane helix becomes unwound, resulting in repositioning of the cytoplasmic domains. Throughout these conformational changes, a series of spherical densities representing potassium ions or water molecules define the pathway for potassium transport through an intramembrane tunnel in KdpA that ultimately delivers ions to sites in the membrane domain of KdpB .

What experimental methods have been most successful in determining the structure of KdpC and the KdpFABC complex?

The most successful experimental approach for determining the structure of the KdpFABC complex has been cryo-electron microscopy (cryo-EM), which has allowed researchers to visualize the complex in different conformational states. The methodological workflow involves:

  • Expression of the KdpFABC complex in E. coli using the endogenous promoter that responds to potassium deficiency

  • Purification via Ni-NTA affinity chromatography followed by size-exclusion chromatography in a buffer containing 25 mM Tris pH 7.5, 10% glycerol, 1 mM TCEP, 100 mM NaCl, and 0.15% n-decyl-β-maltoside

  • Addition of substrate analogs to stabilize specific conformational states

  • Plunge freezing on Ultrafoil grids and imaging using a Titan Krios electron microscope

  • Structure determination using cryoSPARC and refinement of atomic models using PHENIX

  • Analysis of internal cavities using Caver Analyst 2.0 Beta

This approach has been complemented by functional studies, including ATPase activity assays using coupled enzyme systems and electrogenic potassium transport measurements in reconstituted proteoliposomes using either voltage-sensitive dyes or capacitative coupling techniques .

How does the catalytic mechanism of KdpB in the KdpFABC complex compare to other P-type ATPases?

The catalytic mechanism of KdpB follows the Post-Albers cycle characteristic of P-type ATPases, with conformational changes that closely parallel those observed in other family members like SERCA (sarco/endoplasmic reticulum Ca²⁺-ATPase). Structural comparisons between KdpB and SERCA reveal remarkable similarities in the catalytic cycle:

StateKdpB CharacteristicsSERCA CharacteristicsFunctional Significance
E1Unliganded catalytic aspartic acid (Asp307)Unliganded catalytic aspartic acid (Asp351)Ready state for ion binding
E1·ATPAMP-PCP bound in N-domain, γ-phosphate poised for transferSimilar ATP analog binding, conserved Mg²⁺ coordinationPrimed for phosphoryl transfer
E2-PTGES motif engaging catalytic aspartateTGES motif engaging catalytic aspartatePhosphorylated intermediate
E2·PiUnwinding of M2 after Leu85, repositioning of TGES loopUnwinding of M2, similar repositioning of TGES loopPost-hydrolysis state

The key difference lies in the coupling mechanism: while SERCA directly transports calcium ions, KdpB works in concert with KdpA, which contains the primary potassium binding sites. This represents a unique hybrid system where an ATP-driven pump is coupled to a channel-like structure, with KdpC playing an essential stabilizing role in this arrangement .

What are the optimal protocols for expressing recombinant Sorangium cellulosum KdpC?

The optimal expression protocol for recombinant Sorangium cellulosum KdpC utilizes E. coli as an expression host with the endogenous promoter system that responds to potassium deficiency in the media. This approach leverages the natural regulatory mechanisms to induce expression. To maximize yield and maintain protein integrity, researchers should:

  • Culture E. coli in potassium-limited media (typically less than 0.2 mM K⁺) to activate the native promoter

  • Grow cultures at 30°C rather than 37°C to reduce the formation of inclusion bodies

  • Induce expression during mid-log phase and continue for 4-6 hours

  • Include 10% glycerol in lysis buffers to stabilize membrane proteins

  • Use mild detergents such as n-decyl-β-maltoside (0.15%) for membrane solubilization

These conditions have been demonstrated to produce functional protein suitable for structural and biochemical studies. For the full KdpFABC complex, which includes KdpC, special attention should be paid to maintaining the stoichiometric assembly of all subunits during expression .

What purification strategies yield the highest purity and activity for KdpC?

A multi-step purification strategy has proven most effective for obtaining high-purity, active KdpC as part of the KdpFABC complex:

  • Initial Capture: Ni-NTA affinity chromatography using a histidine tag, typically with imidazole gradients from 20 mM (wash) to 300 mM (elution)

  • Intermediate Purification: Size-exclusion chromatography using a buffer containing 25 mM Tris pH 7.5, 10% glycerol, 1 mM TCEP, 100 mM NaCl, and 0.15% n-decyl-β-maltoside

  • Final Polishing: If necessary, ion exchange chromatography can separate any remaining contaminants

Throughout purification, it's essential to maintain the protein in a buffer that preserves the detergent micelle surrounding the hydrophobic regions and includes stabilizing agents like glycerol and reducing agents like TCEP or DTT. The purity and activity of the final preparation should be assessed using SDS-PAGE, Western blotting, and functional assays such as ATPase activity measurements or potassium transport assays in reconstituted proteoliposomes .

How can researchers verify the structural integrity of purified KdpC?

Verifying the structural integrity of purified KdpC involves several complementary techniques:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure content and proper folding

  • Thermal Shift Assays: To evaluate protein stability and the effects of different buffer conditions

  • Limited Proteolysis: To probe the accessibility of cleavage sites as an indicator of proper folding

  • Mass Spectrometry: For accurate molecular weight determination and identification of post-translational modifications

  • Size-Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): To confirm the oligomeric state and homogeneity

  • Native PAGE: To assess complex formation with other KdpFABC subunits

For KdpC specifically, as it functions as part of the larger KdpFABC complex, co-purification with its partner subunits and assessment of the intact complex is often the most relevant approach to ensure structural integrity. Additionally, functional assays that measure ATPase activity or potassium transport can serve as indirect indicators of proper folding and assembly within the complex .

How can mutational analysis of KdpC inform structure-function relationships in the KdpFABC complex?

Mutational analysis of KdpC provides critical insights into its role within the KdpFABC complex and can be approached methodically:

  • Targeted Mutation Strategy:

    • Interface residues between KdpC and other subunits (particularly KdpA and KdpB)

    • Conserved residues identified through sequence alignment across species

    • Residues located near the potassium transport pathway

  • Analytical Techniques:

    • ATPase activity assays to measure the impact on ATP hydrolysis rates

    • Potassium transport measurements in reconstituted proteoliposomes

    • Thermal stability assays to assess complex integrity

    • Structural studies (cryo-EM) of mutant complexes

Key experiments have revealed that mutations in KdpC that disrupt its interaction with KdpB can decouple ATP hydrolysis from potassium transport, suggesting that KdpC plays an essential role in communicating conformational changes between KdpB and KdpA. Additionally, mutations at the KdpC-KdpA interface can alter ion selectivity, indicating that KdpC contributes to the architecture of the potassium transport pathway beyond merely stabilizing the complex .

What are the most effective experimental designs for studying KdpC function in vitro?

The most effective experimental designs for studying KdpC function combine structural, biochemical, and biophysical approaches:

  • Reconstitution Systems:

    • Proteoliposome reconstitution of purified KdpFABC complex

    • Controlled lipid composition to mimic native membrane environment

    • Incorporation of fluorescent potassium indicators or voltage-sensitive dyes

  • Transport Assays:

    • Radioisotope (⁴²K⁺) flux measurements

    • Voltage-sensitive dye (DisC₃) for monitoring membrane potential changes

    • Capacitative coupling measurements using systems like SURFE²R N1

  • Structural Dynamics:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational changes

    • Single-molecule FRET to monitor real-time structural dynamics

    • Cross-linking coupled with mass spectrometry to map interaction interfaces

  • Comparative Analysis:

    • Parallel studies with KdpFABC complexes from different bacterial species

    • Chimeric constructs swapping KdpC domains between species

    • Comparison with simplified model systems for potassium transport

These approaches should be complemented by computational methods, including molecular dynamics simulations to predict ion pathways and energetics of conformational changes within the complex .

How can researchers distinguish between the functions of different domains within KdpC?

Distinguishing between functions of different KdpC domains requires domain-specific analytical approaches:

  • Domain Deletion and Chimera Construction:

    • Generate constructs with specific domains deleted or replaced

    • Create chimeric proteins with domains from homologous proteins

    • Express truncated versions containing only specific domains

  • Domain-Specific Crosslinking:

    • Introduce cysteine residues at strategic positions within specific domains

    • Perform crosslinking under various conditions (ATP binding, potassium concentration)

    • Analyze crosslinked products to identify domain interactions during transport cycle

  • Domain-Specific Labeling:

    • Introduce fluorescent probes at domain-specific sites

    • Monitor conformational changes in specific domains during transport

    • Correlate domain movements with functional states

  • Computational Approaches:

    • Domain-focused molecular dynamics simulations

    • Elastic network modeling to predict domain movements

    • Sequence conservation analysis to identify functionally critical regions

Through these approaches, researchers have identified that KdpC contains membrane-proximal regions that interact with the lipid bilayer, central domains that interface with KdpB, and regions that may contribute to stabilizing the potassium transport pathway through KdpA. The relative immobility of KdpC during the transport cycle suggests its primary role is to provide a stable structural framework that allows the conformational changes in KdpB to be effectively transmitted to the transport pathway .

How does the KdpFABC complex from Sorangium cellulosum compare to homologous complexes in other bacteria?

Comparative analysis of the KdpFABC complex from Sorangium cellulosum and other bacterial species reveals both conserved features and species-specific adaptations:

FeatureSorangium cellulosum KdpFABCE. coli KdpFABCFunctional Implications
Genome ContextEncoded by the kdpFABC operon with sce1354 as the locus name for KdpCSimilar operon structure with regulatory elements responding to K⁺ limitationConservation of regulatory mechanisms despite evolutionary distance
Subunit CompositionFour subunits (KdpF, KdpA, KdpB, KdpC) with conserved domain architectureIdentical subunit compositionFundamental conservation of the transport mechanism
KdpC Size190 amino acids190 amino acids (similar size)Conserved functional requirements for KdpC across species
ATP Binding SiteConserved residues in KdpB for ATP binding and hydrolysisNearly identical ATP binding residuesEvolutionary pressure to maintain catalytic function
Potassium PathwayIntramembrane tunnel through KdpA connecting to sites in KdpBSimilar pathway architectureConservation of transport mechanism

Despite these similarities, differences exist in the details of transmembrane helix arrangements, particularly in KdpA, which may reflect adaptations to different membrane environments or potassium availability in their respective ecological niches. Sorangium cellulosum, as a soil-dwelling organism, may have evolved specific adaptations for dealing with fluctuating potassium levels in soil environments .

What are the current challenges and controversies in understanding KdpC function?

Several significant challenges and controversies currently exist in KdpC research:

  • Precise Role in Transport Mechanism:

    • Some studies suggest KdpC is merely a structural stabilizer

    • Other evidence indicates it actively participates in coupling ATP hydrolysis to ion transport

    • Resolving these views requires more detailed structural and functional analyses

  • Species-Specific Adaptations:

    • Limited structural data across diverse bacterial species

    • Unclear how KdpC variations affect function in different ecological niches

    • Need for comparative functional studies across evolutionary diverse bacteria

  • Methodological Limitations:

    • Challenges in expressing and purifying the complex in sufficient quantities

    • Difficulty in capturing transient conformational states during transport

    • Technical obstacles in reconstituting fully functional complexes in artificial membranes

  • Regulatory Interactions:

    • Poorly understood interactions with other cellular components

    • Limited knowledge of post-translational modifications affecting KdpC function

    • Unclear mechanisms of complex assembly and membrane insertion

  • Therapeutic Potential:

    • Debated suitability as an antimicrobial target

    • Conflicting evidence on essentiality across different bacterial species

    • Challenges in developing specific inhibitors

Resolution of these controversies will require integration of advanced structural methods, single-molecule approaches, and systems biology perspectives to place KdpC function in its proper cellular context .

How can structural insights into KdpC contribute to understanding broader principles of ion transport mechanisms?

The structural insights into KdpC and the KdpFABC complex contribute to our understanding of broader ion transport principles in several ways:

  • Hybrid Transport Mechanisms:

    • KdpFABC represents a unique hybrid between channel-like (KdpA) and pump-like (KdpB) components

    • Understanding how KdpC facilitates communication between these components can inform models of other complex transport systems

    • Provides insights into how nature evolves specialized solutions to fundamental physiological challenges

  • Allostery in Membrane Proteins:

    • The static nature of KdpC during transport cycle highlights its role in allosteric communication

    • Reveals principles of energy transduction between distant protein domains

    • Demonstrates how rigid domains can facilitate rather than participate in conformational changes

  • Adaptation to Environmental Stress:

    • KdpFABC is expressed under potassium limitation, representing a stress response

    • Study of KdpC provides insights into how transporters can be optimized for function under stress conditions

    • Reveals evolutionary adaptations for maintaining ion homeostasis in challenging environments

  • Co-Evolution of Transport Complexes:

    • Sequence analysis of KdpC across species can reveal co-evolutionary patterns with other subunits

    • Identifies critical interaction networks maintaining functional coupling

    • Provides a model for studying the evolution of multisubunit membrane complexes

These insights have implications beyond prokaryotic potassium transport, potentially informing our understanding of other multicomponent transport systems, including those in eukaryotes involved in human disease processes .

What are the best practices for designing research questions about KdpC?

Designing effective research questions about KdpC requires careful consideration of several factors:

Following these practices ensures that research on KdpC generates meaningful, interpretable data that advances our understanding of this important component of bacterial potassium transport systems .

What specialized equipment and resources are required for advanced KdpC research?

Advanced research on KdpC requires specialized equipment and resources:

  • Structural Analysis:

    • Cryo-electron microscope (preferably Titan Krios or equivalent)

    • High-performance computing for image processing and structure determination

    • Software packages (cryoSPARC, RELION, PHENIX)

    • Access to synchrotron facilities for complementary X-ray crystallography

  • Protein Expression and Purification:

    • Controlled environment fermenters for large-scale bacterial culture

    • Fast protein liquid chromatography (FPLC) systems

    • Specialized columns for membrane protein purification

    • Analytical ultracentrifuge for complex characterization

  • Functional Analysis:

    • SURFE²R N1 or equivalent for capacitative coupling measurements

    • Fluorescence plate readers for transport assays

    • Isotope handling facilities for radioisotope flux measurements

    • Reconstitution equipment for proteoliposome preparation

  • Molecular Biology:

    • Site-directed mutagenesis equipment

    • Real-time PCR systems for expression analysis

    • Next-generation sequencing access for genomic context studies

    • CRISPR-Cas9 or equivalent for genetic manipulation

  • Computational Resources:

    • High-performance computing clusters for molecular dynamics simulations

    • Specialized software for membrane protein modeling and simulation

    • Bioinformatics pipelines for comparative genomics and protein analysis

  • Collaborative Networks:

    • Access to microbiology expertise for Sorangium cellulosum cultivation

    • Connections with structural biology facilities

    • Partnerships with computational biology groups

This comprehensive suite of resources enables the multidisciplinary approach necessary for cutting-edge KdpC research, though smaller-scale studies can be conducted with more limited resources focusing on specific aspects of KdpC biology .

How can researchers troubleshoot common experimental challenges when working with KdpC?

Researchers working with KdpC commonly encounter several challenges that can be systematically addressed:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.