Recombinant Sorangium cellulosum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; sce3136; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
crcB
Target Protein Sequence
MERWFWIGLGGAAGTLARYGLSTWCQQRFGAEFPYGTLAVNVIGSFLLGAIGEIAATTEL LSPTLRLSLSTGVMGGFTTYSSFNNETIRLIEYKSWAAGLANIAITLVVCLLAGVLGMVV ARRLIAG
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links

KEGG: scl:sce3136

STRING: 448385.sce3136

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Sorangium cellulosum Protein CrcB homolog?

Recombinant S. cellulosum Protein CrcB homolog (crcB) is a bacterial membrane protein belonging to a superfamily predominantly composed of transporters . When produced recombinantly, the protein is typically expressed with tags (such as His-tag) to facilitate purification and further study. The protein has been associated with fluoride ion transport functionality, suggesting a role in reducing cellular concentrations of this anion to mitigate fluoride toxicity .

What expression systems are commonly used for producing recombinant CrcB protein?

E. coli is the predominant expression system used for recombinant CrcB protein production. Specifically:

  • BL21(DE3) strain is frequently utilized for protein expression with vectors like pET28a and pET29b

  • Expression is typically conducted under controlled conditions with IPTG induction (0.1-1.0 mM)

  • Temperature optimization is critical, with lower temperatures (16°C) often yielding better results for soluble protein expression compared to standard 37°C induction

  • Fusion tags such as MBP (maltose-binding protein) significantly improve solubility of CrcB proteins, as demonstrated in studies where His-tagged versions formed inclusion bodies while MBP-tagged versions remained soluble

What are the basic storage and handling recommendations for recombinant CrcB protein?

Based on established protocols, the following handling procedures are recommended:

ParameterRecommendation
Storage temperature-20°C/-80°C for long-term storage
Working aliquotsStore at 4°C for up to one week
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% Trehalose
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term stabilityAdd glycerol (final concentration 30-50%)
Freeze-thaw cyclesMinimize; repeated freezing and thawing not recommended

How should I design a Randomized Complete Block Design (RCBD) experiment to evaluate CrcB protein function under various conditions?

When investigating CrcB protein function under different conditions (pH, temperature, ion concentrations), a Randomized Complete Block Design provides statistical power by controlling for nuisance factors:

  • Identify blocking factors: Consider laboratory-specific variables (equipment batches, reagent lots, technician differences) that could introduce systematic variation

  • Set up experimental blocks:

    • Each block should contain all treatment combinations

    • Randomize treatments within each block independently

    • Example design for testing four different fluoride concentrations with three replicates:

    Rep 1Rep 2Rep 3
    ABA
    DAB
    CDC
    BCD
  • Analysis considerations:

    • RCBD reduces experimental error by accounting for known sources of variation

    • Allows wider generalization of study findings

    • Each treatment must appear in all blocks for a complete design

    • Missing data can be estimated without compromising the entire experiment

What are the methodological approaches for studying CrcB protein interaction with fluoride ions?

Several complementary approaches can be employed:

  • In-line probing assays:

    • Used to determine structural changes in CrcB upon fluoride binding

    • Enables determination of binding constants (KD ~60 μM for related CrcB RNAs)

    • Can reveal the most highly conserved nucleotides that undergo structural change

  • Growth assays with CrcB knockout organisms:

    • Compare wild-type and CrcB knockout strains at various fluoride concentrations

    • Monitor growth curves and calculate growth inhibition percentages

    • Demonstrates functional role of CrcB in fluoride resistance

  • Reporter gene expression systems:

    • Fluoride-responsive riboswitch-controlled reporter genes (e.g., lacZ fusion)

    • Measure expression at increasing fluoride concentrations to assess in vivo function

    • Shows correlation between CrcB function and fluoride sensing

How can I optimize heterologous expression of difficult-to-express CrcB protein variants?

Optimization of difficult-to-express CrcB variants requires a systematic approach addressing multiple parameters:

  • Vector optimization:

    • Test multiple fusion tags (His, MBP, GST, SUMO)

    • Evaluate different promoter strengths

    • Consider codon optimization for expression host

  • Systematic expression screening:

    • Conduct small-scale trials in 2-ml tubes or 96-well plates before scale-up

    • Test matrix of conditions (temperatures, IPTG concentrations, media types)

    • Implement high-throughput protocols to test over 1000 conditions quickly

  • Addressing protein toxicity:

    • Use tightly controlled inducible systems to minimize basal expression

    • Consider specialized host strains designed for toxic proteins

    • Monitor growth rate pre-induction as indicator of toxicity

  • Solubility enhancement strategies:

    • Co-express with molecular chaperones

    • Use solubility enhancing fusion partners (as shown with MBP tag for LipB, which also applies to CrcB)

    • Optimize buffer conditions during purification

What approaches can be used to investigate structure-function relationships in CrcB proteins?

Understanding structure-function relationships in CrcB proteins requires multiple complementary techniques:

  • Crystallography and structural analysis:

    • X-ray crystallography has been successful for related membrane proteins

    • Molecular docking can predict substrate interactions in binding pockets

    • Structural comparisons with homologs like CYP260A1 from S. cellulosum (PDB: 5LIV) provide insights into catalytic mechanisms

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment

    • Focus on specific domains like the transmembrane regions

    • Example from related protein: S326N mutation increased activity and selectivity

  • Chimeric protein construction:

    • Swap domains between CrcB homologs from different species

    • Identify minimal functional units

    • Use domain swapping to understand specificity determinants

How can differential RNA structure probing experiments be used to study CrcB riboswitch interactions?

For researchers investigating CrcB-associated riboswitches, differential RNA structure probing provides critical insights:

  • Experimental design considerations:

    • Compare riboswitch structure with and without fluoride

    • Use SHAPE-Seq or similar techniques to probe RNA structure

    • Include controls for non-specific effects

  • Analysis framework (DiffScan approach):

    • Normalize structure probing data for high-resolution analysis

    • Identify structurally variable regions (SVRs) between conditions

    • Use benchmark datasets like the Flu dataset from Bacillus cereus crcB fluoride riboswitch

  • Expected outcomes:

    • Typical crcB fluoride riboswitches show 5-7 SVRs ranging from 1-8 nucleotides

    • Focus on regions showing significant structural changes upon fluoride binding

    • Correlate structural changes with functional outputs like gene expression

How does the function of CrcB homologs differ between Sorangium cellulosum and other bacterial species?

CrcB homologs show both conservation and divergence across bacterial species:

  • Distribution patterns:

    • CrcB genes associated with fluoride riboswitches are widely distributed in bacteria and archaea

    • Present in diverse lineages including fungi and plants

    • In some Streptococcus species, EriC F proteins occupy the same genomic location as CrcB proteins in other species, suggesting functional equivalence

  • Functional conservation:

    • Primary role in fluoride toxicity resistance is maintained across species

    • Sequence variation suggests adaptation to different environmental conditions

    • Conserved mechanism despite amino acid sequence diversity

  • Myxobacterial specificity:

    • S. cellulosum CrcB may have additional functions related to the complex social lifestyle of myxobacteria

    • Potential roles in secondary metabolite production or export

    • May interact with the extensive regulatory network in S. cellulosum, which includes an unusually high number of eukaryotic protein kinase-like kinases

How can genome-wide analysis approaches be applied to study CrcB in the context of other membrane proteins in S. cellulosum?

Genome-wide analysis provides broader context for CrcB function:

  • Comparative genomics approach:

    • Analyze 13 sequenced S. cellulosum genomes to identify related proteins

    • Apply sequence similarity network analysis to classify functional families

    • Examine genomic context for clues about function and regulation

  • Integration with metabolic networks:

    • Investigate potential roles in secondary metabolite biosynthesis

    • Examine proximity to biosynthetic gene clusters

    • Example: LipB was adjacent to epothilone biosynthetic cluster and predicted to hydrolyze epothilones to prevent self-toxicity

  • Evolutionary analysis:

    • Construct phylogenetic trees of CrcB homologs across bacterial species

    • Identify conserved domains and variable regions

    • Map mutations to structural models to understand selective pressures

What are common challenges in purifying recombinant CrcB protein and how can they be addressed?

Researchers frequently encounter these challenges when purifying CrcB:

  • Protein insolubility issues:

    • Problem: CrcB proteins often form inclusion bodies (as seen with His-LipB from S. cellulosum)

    • Solution: Use MBP fusion tags which significantly improve solubility

    • Alternative: Optimize induction conditions (0.1 mM IPTG at 16°C for 22h rather than 1 mM at 37°C)

  • Low expression yields:

    • Problem: Membrane proteins typically express at lower levels than cytosolic proteins

    • Solution: Scale up culture volume or use high cell density fermentation

    • Alternative: Test specialized expression strains optimized for membrane proteins

  • Protein instability during purification:

    • Problem: Loss of activity during purification steps

    • Solution: Add stabilizing agents (glycerol, trehalose) to all buffers

    • Data: 6% trehalose in Tris/PBS buffer at pH 8.0 helps maintain stability

How can I address experimental variability when working with CrcB proteins?

Controlling experimental variability requires systematic approaches:

  • Sources of variation in CrcB experiments:

    • Expression batch differences

    • Purification efficiency

    • Storage duration effects

    • Assay component variations

  • Experimental design strategies:

    • Implement Randomized Complete Block Design to control known variables

    • Use appropriate controls for each experimental batch

    • Maintain consistent protocols for protein handling

  • Data analysis approaches:

    • Account for batch effects in statistical analysis

    • Consider using mixed-effects models to separate experimental noise from biological signals

    • Implement appropriate normalization methods for comparative studies

How can recombinant CrcB protein be used to study fluoride transport mechanisms?

Recombinant CrcB offers several experimental approaches for fluoride transport studies:

  • Reconstitution in liposomes:

    • Purified CrcB can be incorporated into artificial membrane systems

    • Transport assays using fluoride-sensitive dyes or electrodes can measure activity

    • Varying lipid composition helps understand membrane environment requirements

  • Mutation analysis approach:

    • Use site-directed mutagenesis to modify predicted pore-lining residues

    • Measure transport rates of wild-type vs. mutant proteins

    • Correlate functional changes with structural predictions

  • Combining with riboswitch studies:

    • Use dual systems examining both CrcB protein and its associated riboswitch

    • Investigate coordinated regulation and function

    • Study how cellular fluoride levels affect both riboswitch conformation and CrcB expression

What research applications exist for studying CrcB in the context of S. cellulosum secondary metabolism?

Several promising research directions connect CrcB to secondary metabolism:

  • Potential roles in metabolite resistance:

    • Investigate whether CrcB protects S. cellulosum from toxic effects of its own secondary metabolites

    • Example: LipB was hypothesized to hydrolyze epothilones to prevent self-toxicity

    • Study co-expression patterns with biosynthetic gene clusters

  • Genomic context analysis:

    • Examine proximity of crcB genes to secondary metabolite biosynthetic clusters

    • S. cellulosum So ce56 contains 17 secondary metabolite loci that could be examined for relationships with CrcB

    • Investigate whether crcB mutations affect secondary metabolite production

  • Applications in strain improvement:

    • Use transcriptional activators like TALE-TF-VP64 and CRISPR/dCas9-VP64 systems to modify CrcB expression

    • Assess impacts on cell fitness and metabolite production

    • Develop CrcB-based selection systems for strain development

What emerging technologies could advance research on CrcB proteins?

Several cutting-edge approaches show promise for CrcB research:

  • Cryo-electron microscopy:

    • High-resolution structural studies of membrane-embedded CrcB

    • Visualization of conformational changes during transport

    • Determination of oligomerization states in native-like environments

  • Advanced genome editing in S. cellulosum:

    • Application of CRISPR/Cas9 systems for precise genetic manipulation

    • Development of inducible expression systems for CrcB

    • Creation of reporter fusions to study localization and expression dynamics

  • Single-molecule techniques:

    • FRET studies to examine conformational changes during transport

    • Single-particle tracking to study CrcB dynamics in membranes

    • Correlative microscopy to link structure, localization, and function

How might understanding CrcB function contribute to synthetic biology applications?

CrcB research has several potential synthetic biology applications:

  • Fluoride biosensors:

    • Engineer CrcB-based systems for environmental fluoride detection

    • Develop fluoride-responsive genetic circuits using CrcB riboswitches

    • Create whole-cell biosensors for environmental monitoring

  • Biocontainment strategies:

    • Develop fluoride-dependent growth systems as biocontainment mechanisms

    • Engineer organisms requiring fluoride for survival through modified CrcB systems

    • Create genetic safeguards based on fluoride sensing

  • Protein engineering platforms:

    • Use CrcB as a scaffold for developing novel ion transporters

    • Engineer substrate specificity for biotechnological applications

    • Develop chimeric proteins with novel functions based on CrcB architecture

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.