Recombinant Sorangium cellulosum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant uppP derived from Sorangium cellulosum strain So ce56 has been characterized with the following properties:

ParameterDetails
UniProt IDA9GC83
Gene Locussce5989
Expression RegionAmino acids 1–307 (full-length protein)
Molecular Weight~35 kDa (calculated from 307-amino acid sequence)
TagDetermined during production (commonly polyhistidine or GST for purification)
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C
Catalytic ActivityEC 3.6.1.27; hydrolysis of undecaprenyl pyrophosphate to monophosphate

Active Site and Mechanism

uppP is an integral membrane protein with two conserved motifs critical for catalysis:

  • Motif 1: (E/Q)XXXE (residues 64–68 in E. coli homolog)

  • Motif 2: PGXSRSXXT (residues 177–185)

Molecular dynamics simulations suggest these motifs form a periplasm-oriented active site, facilitating interaction with undecaprenyl pyrophosphate. A histidine residue (His154 in E. coli) further stabilizes the reaction intermediate .

Substrate Specificity

The enzyme exhibits strict specificity for C55-PP, making it a target for antibiotics like bacitracin, which binds undecaprenyl pyrophosphate to inhibit recycling .

Expression Systems

  • Host: Typically expressed in Escherichia coli with fusion tags (e.g., bacteriorhodopsin) to enhance solubility and purification .

  • Yield: Commercial sources offer 50 µg quantities, though scalability remains challenging due to membrane protein complexity .

Industrial Relevance

uppP is studied for:

  • Antibiotic Development: Bacitracin resistance mechanisms linked to uppP overexpression .

  • Cell Wall Synthesis: Essential for Gram-negative and Gram-positive bacteria, offering insights into bacterial physiology .

Sorangium cellulosum Strain So ce56

  • Genome Size: 13.03 Mbp (largest bacterial genome sequenced as of 2007) .

  • Secondary Metabolism: Harbors 17 secondary metabolite clusters, though uppP itself is part of primary cell wall synthesis .

Comparative Genomics

uppP homologs are widespread in bacteria but absent in eukaryotes, highlighting its role as a prokaryote-specific therapeutic target .

Key Research Findings

Study FocusKey ResultReference
Active Site LocalizationPeriplasmic orientation confirmed via mutagenesis and molecular modeling
Catalytic Motifs(E/Q)XXXE and PGXSRSXXT motifs essential for phosphatase activity
Bacitracin ResistanceuppP overexpression reduces bacitracin sensitivity in E. coli

Challenges and Future Directions

  • Structural Studies: No crystallographic data available; further work needed to resolve 3D architecture.

  • Biotechnological Optimization: Improving recombinant yields for high-throughput screening.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; sce5989; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
uppP
Target Protein Sequence
MFWFDAVLLGVLEGLTEFLPVSSTGHLILLGAWLGHQSEAAKTLDIVIQLGAVLAVVVYF RERLSTTVRGMVRRDPDSLRLALALAFAFLPAAVVGLLFHKAIKAHLFGPGPVAAALIVG GFLMIGVESLRRRRPDQGAPRVEDVTFQRALAIGFAQCFSLWPGASRSMTTIVGGQLSGL STAAAAEFSFLLAIPTLGAATVFDLVKNGRALLDAPGGIVALVVGLAVSFAVALLVIAVF LRYLKRYGLAPFGWYRIALGALVLWLWIASRSAPAEAGAASASPAPRGDVAAAVDGLART GDHPSRP
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: scl:sce5989

STRING: 448385.sce5989

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Undecaprenyl-diphosphatase in bacterial systems?

Undecaprenyl-diphosphatase (uppP), classified as EC 3.6.1.27, is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (or undecaprenyl diphosphate, UPP) to undecaprenyl phosphate (UP). This reaction is essential for bacterial cell wall synthesis as UP serves as a lipid carrier for peptidoglycan building blocks across the cell membrane .

The enzyme is also known as Bacitracin resistance protein in some contexts, as it plays a role in bacterial resistance to certain antibiotics . The dephosphorylation catalyzed by uppP is a crucial step in maintaining the supply of undecaprenyl phosphate, which functions as the "Universal Glycan Lipid Carrier" in bacterial cell wall synthesis pathways . When uppP activity is inhibited, peptidoglycan synthesis is interrupted, potentially leading to cell lysis, making it an attractive target for antibiotic development .

What are the structural characteristics of Sorangium cellulosum uppP?

Sorangium cellulosum uppP is a 307-amino acid integral membrane protein with multiple transmembrane domains. Its complete amino acid sequence is:

MFWFDAVLLGVLEGLTEFLPVSSTGHLILLGAWLGHQSEAAKTLDIVIQLGAVLAVVVYFRERLSTTVRGMVRRDPDSLRLALALAFAFLPAAVVGLLFHKAIKAHLFGPGPVAAALIVGGFLMIGVESLRRRRPDQGAPRVEDVTFQRALAIGFAQCFSLWPGASRSMTTIVGGQLSGLSTAAAAEFSFLLAIPTLGAATVFDLVKNGRALLDAPGGIVALVVGLAVSFAVALLVIAVFLRYLKRYGLAPFGWYRIALGALVLWLWIASRSAPAEAGAASASPAPRGDVAAAVDGLARTGDHPSRP

Like other bacterial undecaprenyl-diphosphatases, the protein likely contains conserved motifs important for its catalytic function. Research on E. coli UppP suggests the enzyme's active site is composed of (E/Q)XXXE and PGXSRSXXT motifs and a histidine residue, positioned within the periplasmic region of the protein . Although the specific active site of S. cellulosum uppP has not been definitively characterized in the available research, it likely shares similar catalytic machinery based on functional homology.

What are the established assays for measuring undecaprenyl-diphosphatase activity?

Researchers can employ several methodological approaches to measure uppP activity:

  • Phosphate Colorimetric Assay: This widely used method measures released phosphate using colorimetric detection. The reaction mixture typically contains buffer (e.g., 50 mM Hepes at pH 7.0), 150 mM NaCl, 10 mM MgCl₂, a detergent like 0.02% DDM, substrate (often Farnesyl pyrophosphate/Fpp as a model substrate), and purified uppP. The released phosphate is quantified using Malachite Green reagent with absorbance measured at 650 nm .

  • Radiometric Assay: For verification of IC₅₀ values and inhibition studies, a radiometric assay using radiolabeled substrates (e.g., [³H]IPP) can be employed .

  • Continuous Spectrophotometric Assay: This assay monitors the condensation of substrates catalyzed by uppP in real-time using a spectrophotometric approach with reagents like MESG (2-amino-6-mercapto-7-methylpurine ribonucleoside) .

For kinetic parameter determination, researchers typically use varying substrate concentrations (e.g., 0.3–57 μM Fpp) with 20–40 nM of purified enzyme. The resulting data are fitted to the Michaelis-Menten equation to obtain Km and kcat values .

How can researchers effectively express and purify recombinant S. cellulosum uppP?

While the search results don't provide specific protocols for S. cellulosum uppP, membrane proteins like uppP generally require specialized approaches:

  • Expression System Selection: E. coli expression systems with vectors containing strong, inducible promoters are commonly used. For membrane proteins, strains like C41(DE3) or C43(DE3) often yield better results.

  • Solubilization and Extraction: Due to uppP being an integral membrane protein, effective solubilization using detergents is essential. Commonly used detergents include DDM (n-dodecyl-β-D-maltoside), which was mentioned in the activity assays .

  • Purification Strategy:

    • Initial purification typically employs affinity chromatography (the recombinant protein may include tags determined during the production process )

    • Further purification may involve ion-exchange chromatography and size-exclusion chromatography

    • Buffer conditions should be optimized to maintain protein stability, typically including detergents and sometimes glycerol

  • Storage Considerations: The recombinant protein is typically stored in Tris-based buffer with 50% glycerol, optimized for this specific protein, at -20°C. For extended storage, -80°C is recommended, and repeated freeze-thaw cycles should be avoided .

How does uppP contribute to peptidoglycan synthesis pathways?

Undecaprenyl-diphosphatase (uppP) plays a pivotal role in peptidoglycan synthesis through the following mechanisms:

  • Carrier Lipid Generation: The enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), creating the essential carrier lipid required for peptidoglycan synthesis .

  • Precursor Transport: UP functions as a lipid carrier that transports peptidoglycan precursors across the bacterial cell membrane. During this process, N-acetylglucosamine and N-acetylmuramic acid are linked to UP on the cytoplasmic side of the membrane before being carried across .

  • Recycling Mechanism: UP works in a cycle of phosphorylation and dephosphorylation as the lipid carrier is used, recycled, and reacts with undecaprenyl phosphate. This represents a form of de novo synthesis where complex molecules are created from simpler molecules .

  • Integration with Cell Wall Assembly: The peptidoglycan synthesis pathway begins with MurA catalyzing the reaction of UDP-GlcNAc with phosphoenolpyruvate to form MurNAc. After several enzymatic steps involving MurC, D, E, and F that add amino acids to form the pentapeptide, the undecaprenyl phosphate carrier (generated by uppP) becomes critical for transporting these building blocks across the membrane for final assembly into the cell wall .

The inhibition of uppP activity disrupts this essential pathway, potentially leading to cell lysis, making it an important target for antibiotic development .

How does the synthesis and function of undecaprenyl phosphate differ between Gram-positive and Gram-negative bacteria?

The synthesis pathway of undecaprenyl phosphate shows significant differences between Gram-positive and Gram-negative bacteria:

  • Gram-positive bacteria:

    • Contain abundant undecaprenol, which is then phosphorylated to form undecaprenyl phosphate (UP)

    • Direct phosphorylation pathway is predominant

  • Gram-negative bacteria:

    • No significant quantities of undecaprenol have been detected

    • Instead of direct phosphorylation of undecaprenol, they primarily utilize dephosphorylation of undecaprenyl diphosphate

    • This dephosphorylation is catalyzed by two types of enzymes:
      a) Type-2 phosphatidic acid phosphatase homologue
      b) BacA homologue (uppP)

These differences in synthesis pathways may reflect evolutionary adaptations to different cell wall structures and could potentially be exploited for the development of species-specific antibiotics that target one pathway over the other.

What methods are available for quantifying intracellular polyprenyl diphosphates?

Recent methodological advances have enabled the direct quantification of intracellular polyprenyl diphosphates, which was previously not possible. The established method involves:

  • Sample Preparation:

    • Lipid extraction from bacterial cells (e.g., E. coli)

    • Chemical phosphorylation of polyprenols (e.g., from Staphylococcus aureus) to prepare standards

  • Fractionation via Ion-Exchange Chromatography:

    • Separation of polyprenyl phosphates and diphosphates based on charge differences

  • High-Performance Liquid Chromatography (HPLC):

    • Using an elution solvent containing tetraethylammonium phosphate as an ion-pair reagent

    • This enables separation of polyprenyl phosphate and polyprenyl diphosphate with carbon numbers from 40 to 55 as distinct peaks from a reversed-phase column

This analytical method has been successfully applied to lipids extracted from E. coli to determine the intracellular levels of octaprenyl phosphate, undecaprenyl phosphate, octaprenyl diphosphate, and undecaprenyl diphosphate. This represents the first reported method for separate measurement of cellular levels of polyprenyl phosphates and polyprenyl diphosphates .

What are the technical challenges in studying membrane-bound enzymes like uppP?

Studying membrane-bound enzymes like uppP presents several technical challenges:

  • Expression and Purification Obstacles:

    • Low expression levels compared to soluble proteins

    • Difficulty in extracting proteins from the membrane without denaturation

    • Need for detergents or membrane mimetics to maintain native conformation

    • Risk of protein aggregation or misfolding during purification

  • Assay Development Complexities:

    • Requirement for detergents in assay buffers that may interfere with activity measurements

    • Limited substrate solubility in aqueous solutions

    • Potential artifacts due to detergent micelles or lipid environments

  • Structural Characterization Limitations:

    • Challenges in crystallizing membrane proteins for X-ray crystallography

    • Size limitations for NMR studies

    • Difficulty in capturing different conformational states

  • Buffer Optimization:

    • The assay conditions (pH, salt concentration, detergent type/concentration) significantly affect enzyme activity

    • For instance, uppP activity assays typically require careful optimization of conditions such as:

      • pH range (often tested from pH 5-9 using different buffers)

      • Detergent concentration (e.g., 0.02% DDM)

      • Divalent cation concentration (typically 10 mM MgCl₂)

Why is uppP considered a promising target for novel antibiotics?

Undecaprenyl-diphosphatase (uppP) represents a promising target for novel antibiotics for several compelling reasons:

  • Essential Role in Cell Wall Synthesis: The enzyme catalyzes a crucial step in peptidoglycan biosynthesis, which is essential for bacterial cell survival. Inhibition of uppP activity interrupts peptidoglycan synthesis and can lead to cell lysis .

  • Novel Target Pathway: With rising resistance to current antibiotics including methicillin and vancomycin, targeting new steps in cell wall biosynthesis may help combat resistant strains like MRSA and VRE .

  • Potential for Combination Therapy: Inhibitors acting on new targets in cell wall biosynthesis might restore sensitivity to existing drugs. Since uppP is involved in the same pathway as some current antibiotics but acts at a different step, combination therapy could be particularly effective .

  • Absence in Humans: The undecaprenyl diphosphate pathway isn't present in humans, potentially reducing side effects and increasing selectivity of drugs targeting this enzyme .

  • Role in Multiple Bacterial Processes: Beyond peptidoglycan synthesis, undecaprenyl phosphate is involved in the metabolism of other cellular processes that could be targeted by antibiotics, making it a multifaceted target .

Previous screening efforts by pharmaceutical companies have yielded limited success, with SmithKline Beecham reporting no chemically tractable low micromolar hits, and Novartis pursuing certain chemical classes but noting various issues . This suggests that while challenging, successful development of uppP inhibitors could represent a significant breakthrough in antibiotic discovery.

What approaches have been used to identify potential inhibitors of uppP?

Several methodological approaches have been employed to identify potential inhibitors of undecaprenyl-diphosphatase:

  • Structure-Based Virtual Screening:

    • Utilizing multiple crystal structures of UPPS (Undecaprenyl diphosphate synthase, which works in the same pathway)

    • Validating virtual screening models using known inhibitors and decoys

    • For example, one study used 12 UPPS X-ray structures to validate screening models, then screened ~100,000 compounds selected for drug-like activity from a larger library of ~450,000 compounds

  • High-Throughput Screening Assays:

    • Continuous spectrophotometric assays monitoring enzyme activity in 96-well plates

    • Reaction mixtures typically containing substrates like IPP and FPP, along with components like MESG (2-amino-6-mercapto-7-methylpurine ribonucleoside)

  • Hit Verification and Optimization:

    • Verifying hits using secondary assays (e.g., radiometric assays with [³H]IPP)

    • Fitting inhibition data to dose-response functions using software like GraphPad PRISM

    • Structural optimization of promising leads

  • Computer Modeling and Molecular Dynamics:

    • Proposing enzyme active sites through computational modeling

    • Using molecular dynamics simulations to understand protein-inhibitor interactions

  • Site-Directed Mutagenesis:

    • Creating targeted mutations in proposed active site regions

    • Measuring the effects on enzyme activity to validate structural models and inhibitor binding sites

One study identified a promising lead compound structurally similar to epalrestat (a drug used to treat diabetic neuropathy), which demonstrated inhibitory activity against Gram-positive bacteria .

How can researchers address the species-specific differences in uppP structure and function?

Addressing species-specific differences in uppP requires sophisticated comparative approaches:

  • Comparative Genomics and Phylogenetic Analysis:

    • Systematic comparison of uppP genes and proteins across bacterial species

    • Identification of conserved domains versus variable regions

    • Construction of phylogenetic trees to understand evolutionary relationships

  • Structural Biology Approaches:

    • Comparative crystallography or cryo-EM studies of uppP from different species

    • Homology modeling based on solved structures

    • Analysis of species-specific binding pockets or catalytic residues

  • Functional Complementation Studies:

    • Expression of heterologous uppP genes in model organisms

    • Assessment of whether uppP from one species can functionally replace that of another

    • Identification of species-specific functional requirements

  • Substrate Specificity Analysis:

    • Comparative kinetic studies with varying substrates

    • Analysis of species-specific preferences for substrate length or modification

    • For example, comparison of activity with undecaprenyl diphosphate versus octaprenyl diphosphate, which have been shown to coexist in bacteria like E. coli

  • Development of Species-Selective Inhibitors:

    • Design of compounds targeting unique structural features

    • Screening against panels of purified enzymes from different species

    • Testing inhibitor specificity in various bacterial species

These approaches can help researchers understand the fundamental differences between uppP enzymes from various bacterial species, potentially enabling the development of species-specific antibiotics or broader-spectrum agents depending on the therapeutic goal.

What are the current methodological limitations in studying the catalytic mechanism of uppP?

Current methodological limitations in studying the catalytic mechanism of uppP include:

  • Structural Characterization Challenges:

    • Difficulty in obtaining high-resolution crystal structures of membrane proteins

    • Challenges in capturing different conformational states during the catalytic cycle

    • Limited ability to visualize the enzyme-substrate complex due to the transient nature of the interaction

  • Kinetic Analysis Complexities:

    • Challenge of separating binding events from catalytic steps

    • Difficulty in monitoring real-time changes during catalysis

    • Need for specialized techniques to measure rapid kinetics in membrane-embedded enzymes

  • Substrate Availability and Specificity:

    • Limited commercial availability of natural substrates like undecaprenyl diphosphate

    • Reliance on substrate analogues (e.g., Fpp) that may not perfectly mimic natural substrates

    • Challenges in synthesizing labeled substrates for mechanistic studies

  • Technical Constraints in Mutational Analysis:

    • Difficulty in expressing mutant forms of membrane proteins

    • Potential for mutations to affect protein folding or membrane insertion

    • Challenges in distinguishing direct catalytic effects from structural perturbations

  • Limitations in Current Analytical Methods:

    • While recent advances have enabled measurement of intracellular polyprenyl diphosphates , temporal and spatial resolution remains limited

    • Difficulty in correlating in vitro enzymatic parameters with in vivo function

    • Challenges in monitoring enzyme activity in native membrane environments

Addressing these limitations will require interdisciplinary approaches combining structural biology, enzymology, synthetic chemistry, and advanced analytical techniques to fully elucidate the catalytic mechanism of uppP.

What emerging technologies could advance our understanding of uppP function and inhibition?

Several emerging technologies hold promise for advancing uppP research:

  • Cryo-Electron Microscopy Advances:

    • Developments in single-particle cryo-EM for smaller membrane proteins

    • Potential for visualizing uppP in different conformational states

    • Ability to study the enzyme in more native-like lipid environments

  • Native Mass Spectrometry:

    • Characterization of membrane protein-lipid interactions

    • Analysis of inhibitor binding under near-native conditions

    • Monitoring of post-translational modifications

  • Advanced Computational Methods:

    • Enhanced molecular dynamics simulations with improved force fields for membrane proteins

    • Machine learning approaches to predict inhibitor binding and efficacy

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to study reaction mechanisms

  • Lipid Nanodisc Technology:

    • Study of uppP in defined lipid environments that better mimic native membranes

    • Investigation of how membrane composition affects enzyme activity

    • Platform for more physiologically relevant drug screening

  • CRISPR-Based Approaches:

    • Precise genome editing to create conditional mutants

    • In vivo tracking of uppP function in real-time

    • High-throughput screening of genetic interactions

  • Microfluidic Systems:

    • Single-cell analysis of uppP function and inhibition

    • Rapid screening of inhibitor libraries

    • Controlled gradients for studying enzyme kinetics under varying conditions

These technologies could significantly enhance our ability to study uppP structure, function, and inhibition, potentially accelerating the development of novel antibiotics targeting this essential enzyme.

How might synthetic biology approaches contribute to understanding uppP and developing new inhibitors?

Synthetic biology offers innovative approaches to uppP research and inhibitor development:

  • Engineered Expression Systems:

    • Development of optimized expression systems for difficult membrane proteins

    • Cell-free protein synthesis platforms for rapid production and screening

    • Expression of uppP variants with modified activities or substrate specificities

  • Biosensor Development:

    • Creation of whole-cell biosensors that report on uppP activity

    • High-throughput screening platforms for inhibitor discovery

    • Real-time monitoring of enzyme function in vivo

  • Directed Evolution:

    • Evolution of uppP variants with altered substrate specificity

    • Selection for enzyme variants resistant to inhibitors to understand resistance mechanisms

    • Development of uppP variants as research tools

  • Minimal Cell Systems:

    • Investigation of uppP function in simplified cellular contexts

    • Determination of the minimal requirements for peptidoglycan synthesis

    • Testing of inhibitor efficacy in reduced-complexity environments

  • Metabolic Engineering:

    • Reconstitution of complete peptidoglycan synthesis pathways in heterologous hosts

    • Engineering of alternative pathways to bypass uppP function

    • Evaluation of synthetic lethal interactions for combination therapy approaches

  • Combinatorial Chemistry and Biosynthesis:

    • Generation of diverse inhibitor libraries through biosynthetic pathways

    • Development of novel compound scaffolds based on natural products

    • In vivo production of potential inhibitors

These synthetic biology approaches could significantly accelerate research on uppP and the development of novel antibiotics, potentially addressing some of the limitations of traditional drug discovery methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.