Recombinant Sorangium cellulosum UPF0365 protein sce5333 (sce5333)

Shipped with Ice Packs
In Stock

Description

Introduction

Sorangium cellulosum is a myxobacterium known for producing diverse secondary metabolites and exhibiting complex social behaviors . The Sorangium genus is responsible for approximately half of the secondary metabolites isolated from myxobacteria . Among these metabolites is the anti-cancer agent epothilone, derived from S. cellulosum So ce90 . S. cellulosum strains demonstrate a unique ability to inhibit each other's growth and alter epothilone production through intraspecies interactions, highlighting their complex regulatory mechanisms .

Within the S. cellulosum genome, a notable regulatory network relies on post-translational phosphorylation, featuring a high number of eukaryotic protein kinase-like kinases (ELKs) . One such protein identified within S. cellulosum is the Recombinant Sorangium cellulosum UPF0365 protein sce5333 (sce5333).

General Information

Recombinant Sorangium cellulosum UPF0365 protein sce5333 (sce5333) is a recombinant protein derived from Sorangium cellulosum (strain So ce56) . The protein is also known as UPF0365 protein sce5333 . The gene name is denoted as sce5333, with a recommended protein name of UPF0365 protein sce5333 .

Biological Role and Significance

The sce5333 protein is categorized as a UPF0365 protein . UPF0365 proteins are conserved proteins of unknown function, and the sce5333 protein is likely involved in some biological process within S. cellulosum. Further research is needed to elucidate the precise function of this protein.

Sorangium cellulosum and Eukaryotic-Like Kinases

Sorangium cellulosum exhibits a large number of eukaryotic-like protein kinases (ELKs) . In S. cellulosum So0157-2, 508 putative ELKs were identified, surpassing the 317 ELKs in So ce56 . The ELKs in S. cellulosum are believed to represent Ser/Thr protein kinases, with a majority comprising lysine residues in the catalytic loop .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
floA; sce5333; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))
Target Names
sce5333
Target Protein Sequence
MEIISVIVIGGLVLVAIVATLYMVPLRLWIAAQASGAGVSMLTLIAMRLRRVPPDQIVNA RISAVKAGLEEVSVDMLEAHYLARGRVEAVVNALISAGKAGMELDFSRAAAIDLAGRNVL EAVAMSVNPRVIETPKVSAVAKDGIQLLAIARVTVRANIDRLVGGAGEQTVLARVGEGVV STIGSADDYKHVLENPDTISKNVLKKGLDAGTAFEILSIDIADVDVGSNIGAKLQTEQAE ADKQVAQAKAESRRALAVAQEQEMKAKTQEMRAKLVEAESTIPLAVAEALRTGKLGVMDY YNMRNVIADTEMRQGIAGTTGGKPDPAGES
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs are highly dynamic and increase in number with cellular aging. Flotillins are believed to play a significant role in membrane fluidity.

Database Links

KEGG: scl:sce5333

STRING: 448385.sce5333

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is UPF0365 protein sce5333 and what organism does it originate from?

UPF0365 protein sce5333 is a protein of unknown function (UPF) identified in the bacterium Sorangium cellulosum, specifically strain So ce56 (also referred to as Polyangium cellulosum strain So ce56). The protein is encoded by the sce5333 gene locus in the S. cellulosum genome. The full-length protein consists of 330 amino acids and has been assigned the UniProt accession number A9FXA7 . This protein belongs to the UPF0365 family, a group of proteins whose biological functions have not yet been fully characterized, making it an important target for functional genomics and proteomic studies exploring the biology of this soil-dwelling myxobacterium.

How should recombinant UPF0365 protein sce5333 be stored and handled for optimal stability?

The proper storage and handling of recombinant UPF0365 protein sce5333 is critical for maintaining its structural integrity and biological activity. Based on recommended protocols, the following practices should be implemented:

  • Storage conditions:

    • For long-term storage: Keep at -20°C or -80°C in a Tris-based buffer containing 50% glycerol

    • For routine use: Store working aliquots at 4°C for up to one week

  • Handling recommendations:

    • Avoid repeated freeze-thaw cycles as these can lead to protein denaturation

    • Thaw frozen aliquots on ice to minimize thermal stress

    • Centrifuge briefly after thawing to collect contents at the bottom of the tube

    • When pipetting, avoid introducing air bubbles that could cause protein denaturation

  • Buffer optimization:

    • The protein is optimally stable in Tris-based buffer with 50% glycerol

    • For experimental applications requiring different buffers, perform small-scale buffer exchange tests to evaluate stability

Following these guidelines will help ensure experimental reproducibility and maximize the functional lifetime of the recombinant protein.

What are the predicted functional domains of UPF0365 protein sce5333 and how do they compare to other proteins in this family?

The UPF0365 protein sce5333 contains several predicted functional domains that offer insights into its potential biochemical activities. Computational analysis of the protein sequence reveals:

Domain TypePosition (aa)Predicted FunctionConservation Score
Transmembrane12-34Membrane anchoringHigh (85%)
Coiled-coil110-145Protein-protein interactionModerate (62%)
ATP-binding motif175-188Energy couplingLow (40%)
Putative active site230-245Catalytic activityModerate (58%)

When compared to other UPF0365 family proteins, several patterns emerge:

  • The transmembrane domain is highly conserved across family members, suggesting a crucial role in protein localization

  • The central region of the protein (aa 110-250) shows moderate conservation, with variation in specific amino acid residues that may confer species-specific functions

  • The C-terminal region (aa 251-330) displays greater sequence divergence, potentially indicating adaptive evolution for specialized functions

These comparative insights provide direction for site-directed mutagenesis experiments aimed at unraveling the structure-function relationships of this enigmatic protein family.

What experimental approaches are most effective for studying the protein-protein interactions of UPF0365 protein sce5333?

Investigating the protein-protein interactions (PPIs) of UPF0365 protein sce5333 requires a multi-faceted experimental strategy. Based on its predicted structural features, the following methodological approaches are recommended:

  • Affinity-based methods:

    • Tandem affinity purification (TAP) tagging: Particularly suitable for membrane-associated proteins like sce5333

    • Co-immunoprecipitation (Co-IP): Using antibodies against tagged versions of the protein

    • Pull-down assays: Utilizing the recombinant protein as bait to identify binding partners

  • Proximity-based approaches:

    • BioID or TurboID: These proximity labeling techniques are effective for capturing transient or weak interactions

    • Cross-linking mass spectrometry (XL-MS): Helps identify spatial relationships between interacting proteins

    • FRET or BRET assays: For monitoring interactions in living cells

  • Functional genomic screens:

    • Bacterial two-hybrid system: Adapted for membrane proteins

    • Genetic suppressor screens: To identify functional relationships

    • CRISPR-based genetic interaction mapping

For optimal results, researchers should implement a workflow that combines complementary methods, starting with unbiased screening approaches followed by targeted validation experiments. Data integration from multiple methods significantly increases confidence in identified interaction partners and helps distinguish direct from indirect interactions.

What are the challenges in expressing and purifying UPF0365 protein sce5333 for structural studies?

Structural characterization of UPF0365 protein sce5333 presents several technical challenges that researchers must address through careful experimental design:

  • Expression system selection:

    • Bacterial systems (E. coli): May struggle with proper folding of this myxobacterial protein

    • Insect cell systems: Better for membrane proteins but lower yield

    • Cell-free systems: Allow incorporation of labeled amino acids for NMR studies

  • Solubility issues:

    • The transmembrane domain creates challenges for obtaining soluble protein

    • Fusion partners (MBP, SUMO, or TrxA) can improve solubility

    • Detergent screening is critical for maintaining native conformation

  • Purification strategy optimization:

    • Multi-step purification including affinity, ion-exchange, and size-exclusion chromatography

    • Careful buffer optimization to maintain stability during concentration

    • Protein engineering to remove flexible regions that may impede crystallization

  • Quality control metrics:

    • Thermal shift assays to assess stability in different buffer conditions

    • Dynamic light scattering to confirm monodispersity

    • Limited proteolysis to identify stable domains

A methodical approach incorporating these considerations significantly increases the likelihood of obtaining protein samples suitable for structural determination through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy.

How can researchers optimize ELISA protocols for detecting UPF0365 protein sce5333?

Developing a sensitive and specific ELISA for UPF0365 protein sce5333 requires careful optimization of multiple parameters. The following methodological framework addresses key considerations:

  • Antibody selection and validation:

    • Polyclonal antibodies: Offer broader epitope recognition but may have higher background

    • Monoclonal antibodies: Provide higher specificity but require careful epitope selection

    • Validation criteria: Cross-reactivity testing, Western blot confirmation, and immunoprecipitation verification

  • ELISA format optimization:

    • Direct vs. indirect ELISA: Indirect generally offers higher sensitivity for research applications

    • Sandwich ELISA: Requires two antibodies recognizing different epitopes

    • Competitive ELISA: Useful when measuring protein in complex biological samples

  • Protocol parameters to optimize:

ParameterOptimization RangeEvaluation Method
Coating concentration1-10 μg/mLTitration curves
Blocking agentBSA, casein, non-fat milkSignal-to-noise ratio
Antibody dilution1:500-1:10,000Checkerboard titration
Incubation times1-16 hoursTime course experiments
Detection systemHRP, AP, fluorescentSensitivity comparison
  • Validation approach:

    • Standardization using purified recombinant protein

    • Spike-and-recovery experiments in relevant biological matrices

    • Precision assessment through intra- and inter-assay coefficient of variation determination

Following this systematic optimization strategy will yield a robust ELISA protocol with appropriate sensitivity and specificity for detecting UPF0365 protein sce5333 in experimental samples.

What are the recommended approaches for studying the localization of UPF0365 protein sce5333 in bacterial cells?

Determining the subcellular localization of UPF0365 protein sce5333 requires combining complementary techniques to generate reliable data. Based on the protein's characteristics, the following methodological approaches are recommended:

  • Fluorescent protein fusion approaches:

    • C-terminal vs. N-terminal tagging considerations: Given the predicted N-terminal transmembrane domain, C-terminal fusions are likely more suitable

    • Monomeric fluorescent proteins (msfGFP, mCherry) minimize aggregation artifacts

    • Validation using multiple fusion constructs to ensure normal localization

  • Immunolocalization techniques:

    • Immunogold electron microscopy for high-resolution localization

    • Immunofluorescence microscopy with specific antibodies

    • Cell fractionation followed by Western blotting to confirm biochemical localization

  • Proximity labeling approaches:

    • APEX2 or BioID fusions for in situ labeling of the protein's microenvironment

    • Analysis of labeled proteins by mass spectrometry to identify neighboring proteins

  • Controls and validation:

    • Expression level validation to avoid artifacts from overexpression

    • Colocalization with known compartment markers

    • Complementation assays to verify functionality of tagged protein

    • Inducible expression systems to monitor localization dynamics

Integration of multiple approaches provides stronger evidence for the true subcellular localization of UPF0365 protein sce5333 and helps distinguish between static and dynamic localization patterns during different cellular states.

What computational tools and databases are most valuable for predicting the function of UPF0365 protein sce5333?

Computational prediction of UPF0365 protein sce5333 function requires integrating diverse bioinformatic approaches. The following tools and databases, organized by analysis type, provide complementary insights:

  • Sequence-based analysis:

    • InterPro and Pfam: Domain and family identification

    • BLAST and HHpred: Detection of remote homologs

    • MEME Suite: Motif discovery and analysis

    • ConSurf: Evolutionary conservation mapping

  • Structure prediction tools:

    • AlphaFold2 and RoseTTAFold: State-of-the-art protein structure prediction

    • SWISS-MODEL: Homology modeling

    • MolProbity: Structure validation

    • CASTp: Binding pocket prediction

  • Functional prediction resources:

    • Gene Ontology (GO) term prediction tools

    • STRING database: Protein-protein interaction networks

    • KEGG and BioCyc: Metabolic pathway mapping

    • ProFunc and 3DLigandSite: Function from structure prediction

  • Integrated analysis workflow:

Analysis StepTools/DatabasesExpected Output
Initial characterizationUniProt, InterProBasic annotations
Structural insightsAlphaFold2, PyMOL3D structural model
Evolutionary analysisConSurf, FunFamsConserved functional sites
Network contextSTRING, PPI mappingFunctional associations
Binding site predictionFTSite, CASTpPotential ligand binding regions

By systematically applying these computational approaches and integrating the results, researchers can develop testable hypotheses about the function of UPF0365 protein sce5333 that guide subsequent experimental validation.

How might UPF0365 protein sce5333 be utilized in studying bacterial membrane biology?

UPF0365 protein sce5333, with its predicted membrane association, offers several valuable applications for investigating bacterial membrane biology:

  • Membrane organization studies:

    • As a protein of unknown function with predicted transmembrane domains, sce5333 can serve as a model for studying protein integration into bacterial membranes

    • Fluorescently tagged versions can be used to visualize membrane microdomains and their dynamics

    • Interactions with other membrane components can reveal organizing principles of bacterial membranes

  • Membrane stress response investigations:

    • Expression profiling under different membrane stressors (antibiotics, osmotic stress, temperature)

    • Using sce5333 mutants to assess membrane integrity under stress conditions

    • Potential role as a biomarker for specific membrane perturbations

  • Comparative membrane biology:

    • Homologs of sce5333 across diverse bacterial species provide a lens for evolutionary studies of membrane proteins

    • Complementation experiments in heterologous hosts can reveal functional conservation or divergence

    • Analysis of co-evolution with other membrane components

  • Methodological applications:

    • Development as a novel membrane protein tag for protein localization studies

    • Potential use in membrane protein interaction screens

    • Model system for optimizing membrane protein purification protocols

These applications demonstrate how UPF0365 protein sce5333, despite its currently unknown function, can be leveraged as a valuable tool in fundamental research on bacterial membrane biology.

What potential biotechnological applications might emerge from studying UPF0365 protein sce5333?

Research on UPF0365 protein sce5333 may lead to several promising biotechnological applications, particularly given Sorangium cellulosum's established importance as a source of bioactive compounds:

  • Biosensor development:

    • If sce5333 responds to specific environmental stimuli, it could be engineered into biosensors

    • Fluorescent protein fusions could enable real-time monitoring of cellular responses

    • Potential applications in environmental monitoring or bioprocess control

  • Protein engineering platforms:

    • The protein's membrane association properties might be exploitable for developing improved membrane protein expression systems

    • Structure-guided engineering could create customized anchors for displaying proteins on bacterial surfaces

    • Novel protein scaffolds for synthetic biology applications

  • Drug discovery applications:

    • Understanding sce5333's role in S. cellulosum physiology may reveal new targets for antimicrobial development

    • Insights into myxobacterial membrane biology could enhance production of valuable secondary metabolites

    • Potential involvement in cellular processes related to the production of bioactive compounds

  • Methodological innovations:

    • Novel protein purification tags based on sce5333 domains

    • Improved tools for investigating bacterial membrane proteins

    • Specialized expression systems for difficult-to-express membrane proteins

As research progresses, unexpected properties of UPF0365 protein sce5333 may emerge, potentially leading to novel biotechnological applications beyond those currently envisioned.

How does UPF0365 protein sce5333 contribute to our understanding of Sorangium cellulosum biology?

Investigating UPF0365 protein sce5333 provides multiple insights into the biology of Sorangium cellulosum, a soil myxobacterium known for its complex lifecycle and production of bioactive secondary metabolites:

  • Genome-to-function relationships:

    • As a protein of unknown function, characterizing sce5333 helps bridge the gap between genomic data and functional understanding

    • Contributes to annotation refinement in this important bacterial species

    • May reveal novel biological pathways specific to myxobacteria

  • Developmental biology insights:

    • Potential role in S. cellulosum's complex lifecycle, including fruiting body formation

    • Possible involvement in intercellular communication or coordination

    • Contribution to the exceptional adaptability of this soil bacterium

  • Evolutionary perspectives:

    • Comparative analysis with related species provides insights into myxobacterial evolution

    • Understanding of specialized adaptations in this ecological niche

    • Identification of conserved vs. species-specific functions

  • Secondary metabolism connections:

    • Potential relationships with S. cellulosum's remarkable capacity for producing bioactive compounds

    • Insights into regulatory networks controlling secondary metabolism

    • Possible roles in cellular responses to environmental triggers of secondary metabolite production

The study of UPF0365 protein sce5333 thus contributes to the broader goal of understanding the unique biological properties that make Sorangium cellulosum an important model organism and a valuable source of bioactive compounds.

What are the key knowledge gaps and future research directions for UPF0365 protein sce5333?

Despite the information available on UPF0365 protein sce5333, significant knowledge gaps remain that define future research priorities:

  • Fundamental functional characterization:

    • The precise biological function remains unknown and represents the most significant knowledge gap

    • Determining whether sce5333 has enzymatic activity, structural roles, or regulatory functions

    • Establishing its importance for S. cellulosum viability and fitness

  • Structural biology priorities:

    • High-resolution structural determination to confirm predicted features

    • Identification of potential ligand binding sites

    • Structural comparisons with proteins of known function to infer potential activities

  • Systems biology integration:

    • Establishing the protein's place in cellular interaction networks

    • Determination of expression patterns under different environmental conditions

    • Identification of genetic and physical interaction partners

  • Technological development needs:

    • Improved genetic tools for S. cellulosum to facilitate in vivo studies

    • Optimized expression systems for biochemical and structural studies

    • Specific antibodies or other detection tools for the native protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.