Recombinant Sorbose permease IIC component (sorA)

Shipped with Ice Packs
In Stock

Description

Functional Role in L-Sorbose Metabolism

The sorA protein functions as the membrane-bound IIC component of the PTS, which phosphorylates L-sorbose during uptake. Key mechanistic insights include:

  • Operon Structure: The sor operon (sorCpCDFBAME) encodes regulatory, enzymatic, and transport proteins .

    • sorC: Regulatory protein with repressor-activator functions.

    • sorD: D-glucitol-6-phosphate dehydrogenase.

    • sorA/sorM: Membrane-bound PTS components .

  • Transport Mechanism: SorA collaborates with soluble components (SorB, SorF) to phosphorylate L-sorbose, enabling its catabolism into fructose-6-phosphate .

Genetic and Evolutionary Insights

  • Horizontal Gene Transfer: The sor operon in E. coli shares high homology with Klebsiella pneumoniae, suggesting interspecies transfer .

  • Pathotype-Specific Distribution: Utilization of L-sorbose varies among E. coli pathotypes (e.g., 93% of neonatal meningitis strains vs. 0% in Shigella) .

  • Transcriptional Silencing: Non-utilizing strains (e.g., Shigella, STEC) retain the sor operon but exhibit reduced transcription of sorC and sorD .

Biotechnological Applications

  • Protein Production: Recombinant sorA is commercially available for ELISA and immunogenicity studies .

  • Metabolic Engineering: Introduced into E. coli DH5α to enable growth on L-sorbose as a sole carbon source, demonstrating adaptive potential .

Clinical and Diagnostic Relevance

  • Pathogen Differentiation: L-sorbose utilization aids in distinguishing E. coli pathotypes (e.g., ETEC vs. EPEC) .

  • Selective Media: L-sorbose-containing agar isolates non-utilizing strains (e.g., ETEC) from clinical samples .

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve transport mechanics.

  • Therapeutic Targets: Exploring sorA inhibition to disrupt pathogenic E. coli metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sorA; PTS system sorbose-specific EIIC component; EIIC-Sor; Sorbose permease IIC component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
sorA
Target Protein Sequence
MEISTLQIIAIFIFSCIAGMGSVLDEFQTHRPLIACTVIGLILGDLKTGVMLGGTLELIA LGWMNVGAAQSPDSALASIISAILVIVGHQSIAIGIAIALPVAAAGQVLTVFARTITVVF QHAADKAAEEARFRTIDLLHVSALGVQGLRVAIPALVVSLFVSADMVSSMLSAIPEFVTR GLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGGYLDFSLLAFGGVGVIIALIYIQ LNPQWRKAEPAASTAPSAPALDQLDD
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates simultaneously with their translocation across the cell membrane. The enzyme II SorABFM PTS system is involved in L-sorbose transport.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sorbose permease IIC component (sorA) and how does it function in bacterial systems?

Sorbose permease IIC component (sorA) is a membrane-integrated transport protein that serves as a critical component of the phosphotransferase system (PTS) specifically dedicated to L-sorbose uptake in bacteria. This protein is also referred to as EIIC-Sor or PTS system sorbose-specific EIIC component . The protein functions by forming a transmembrane channel that facilitates the translocation of L-sorbose across the cell membrane during its simultaneous phosphorylation.

The full-length sorA protein consists of 266 amino acids in Klebsiella pneumoniae with a sequence that begins with MEISTLQIIAIFIFSCLAGMGSVLDE and continues through multiple hydrophobic and hydrophilic domains that create its characteristic membrane-spanning topology . These transmembrane segments are essential for substrate recognition and translocation across the membrane barrier. The protein's function is integrated with other components of the sorbose utilization pathway, particularly the phosphorylation cascade that energizes the transport process.

How can researchers effectively isolate and purify recombinant sorA for experimental studies?

The isolation and purification of recombinant sorA requires specialized techniques due to its membrane-associated nature. The methodological approach involves:

  • Expression system selection: Optimal expression of sorA can be achieved using bacterial systems such as E. coli BL21(DE3) with expression vectors containing T7 promoters. The use of fusion tags (His-tag, MBP, or GST) significantly facilitates purification.

  • Membrane protein extraction: Cell disruption should be performed using methods that preserve protein integrity such as sonication in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, and protease inhibitors. Membrane proteins are subsequently solubilized using detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration or CHAPS at 0.5-1.0% .

  • Purification protocols: Affinity chromatography using the appropriate resin based on the fusion tag, followed by size exclusion chromatography provides high purity. The storage buffer typically contains Tris-based buffer with 50% glycerol for stabilization .

For long-term storage, aliquoting the purified protein and storing at -20°C or -80°C is recommended. Repeated freeze-thaw cycles should be avoided, and working aliquots should be maintained at 4°C for up to one week .

How is the sorA gene organized within bacterial genomes and what regulatory elements control its expression?

The sorA gene in bacterial genomes exists within operons dedicated to sorbose metabolism. In E. coli strains capable of utilizing L-sorbose, the sor genes are located at approximately 90 minutes on the genetic linkage map, with the most probable gene order being met-ace-sor-pgi-mal . This organization allows for coordinated regulation of all proteins involved in sorbose utilization.

Regulatory control of sorA expression involves:

  • Carbon catabolite repression: The catabolite repressor protein (CRP) exerts positive control over sor genes, indicating glucose-mediated repression of the operon .

  • Transcriptional regulation: Primer extension analysis in Lactobacillus casei has identified specific promoter regions upstream of sor genes, with transcription start sites that can be determined using primers such as sorF3 and sorR4 .

  • Operon structure: In related sorbose utilization systems, the genes are organized in functional units. For example, in L. casei, multiple genes including sorA, sorB, and sorC have been identified on a 6.8-kb chromosomal DNA fragment .

What experimental approaches can be employed to study sorA-mediated transport kinetics?

Advanced kinetic analysis of sorA-mediated transport requires techniques that can measure substrate translocation rates and affinity parameters. Recommended methodological approaches include:

  • Radioactive substrate uptake assays: Using 14C-labeled sorbose or related substrates (such as 14C-fructose as demonstrated in L. casei studies) at concentrations ranging from 25 to 250 μM. Samples should be collected at intervals (0, 15, 30, 60, and 120 seconds), filtered through membranes, washed, and quantified by scintillation counting .

  • Liposome reconstitution studies: Purified sorA can be incorporated into liposomes containing fluorescent reporters to monitor substrate translocation events in a controlled environment.

  • Electrophysiological measurements: Patch-clamp techniques applied to bacterial spheroplasts or proteoliposomes containing sorA can measure substrate-induced currents.

Time (seconds)Substrate Concentration (μM)Sample Volume (ml)Measurement Method
0, 15, 30, 60, 12025, 75, 125, 2501.0Membrane filtration and scintillation counting

Kinetic parameters should be calculated using Lineweaver-Burk or Eadie-Hofstee transformations to determine Km and Vmax values, which provide insights into substrate affinity and transport capacity.

How can researchers effectively analyze the structure-function relationships in sorA protein through mutagenesis studies?

Structure-function analysis of sorA requires systematic mutagenesis strategies targeting key functional domains:

  • Site-directed mutagenesis approach: Based on the amino acid sequence provided (MEISTLQIIAIFILSCLAGMGSVLDE...), researchers should target conserved residues in transmembrane domains and substrate binding pockets . Particularly, the hydrophobic residues in transmembrane segments and charged residues at interfaces are critical for function.

  • Domain swapping experiments: Chimeric constructs between sorA from different bacterial species (e.g., Klebsiella pneumoniae and E. coli) can help identify species-specific functional domains.

  • Functional complementation assays: Mutated versions of sorA can be tested for their ability to restore sorbose utilization in sorA-deficient strains. Complementation tests have previously identified two genes necessary for L-sorbose utilization in E. coli .

  • Protein stability analysis: Circular dichroism spectroscopy and thermal shift assays should be performed on wild-type and mutant proteins to distinguish between mutations affecting protein stability versus those directly impacting substrate binding or translocation.

The resulting data should be analyzed through comparative transport kinetics studies between wild-type and mutant proteins to establish structure-activity relationships.

What techniques can be employed to study the interaction between sorA and other components of the PTS system?

Investigating protein-protein interactions involving sorA requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against sorA or other PTS components (e.g., phosphocarrier protein HPr encoded by ptsH) to pull down interaction complexes. This method has confirmed that phosphotransferase enzyme I (encoded by ptsI) is required for utilization of L-sorbose .

  • Bacterial two-hybrid system: Construction of fusion proteins with split reporter domains can detect interactions between sorA and other PTS components in vivo.

  • Surface plasmon resonance (SPR): Purified sorA immobilized on sensor chips can be used to measure binding kinetics with other purified PTS components.

  • Cross-linking studies: Chemical cross-linkers that stabilize transient protein-protein interactions can be used to capture the dynamic interactions between sorA and other PTS components during transport.

  • FRET-based interaction assays: Fluorescently labeled sorA and potential interacting partners can reveal proximity-based energy transfer as evidence of interaction.

Analysis of these interactions should account for the requirement of phosphofructokinase (pfkA), phosphocarrier protein (ptsH), and phosphotransferase enzyme I (ptsI) in L-sorbose utilization as demonstrated in E. coli studies .

What are the key considerations for designing experiments to study sorA-mediated sorbose transport under different physiological conditions?

Experimental design for sorA functional studies should account for physiological variables:

  • Growth condition optimization: Cultures should be grown on appropriate media (such as MRS fermentation medium supplemented with 0.5% sugar) to an optical density (OD550) of approximately 0.8 before harvesting for transport assays or enzyme activity measurements .

  • Cell preparation protocols: Bacterial cells should be disrupted using methods appropriate for the specific analysis, such as glass bead disruption for enzyme assays (four periods of 1 minute with 1-minute intervals on ice) .

  • Transport assay conditions: Variables to control include:

    • Temperature (typically 25-37°C depending on the organism)

    • pH (physiological range of 6.0-7.5)

    • Ionic composition of transport buffer

    • Substrate concentration range (25-250 μM has been used in previous studies)

    • Metabolic inhibitors to isolate specific transport components

  • Competition assays: Including structurally related sugars as competitors can reveal the substrate specificity profile of sorA.

Physiological VariableRange to TestControl ConditionMeasurement Endpoint
Temperature20°C, 30°C, 37°C, 42°C37°CInitial transport rate
pH5.5, 6.0, 6.5, 7.0, 7.57.0Transport efficiency
Carbon sourceGlucose, fructose, sorboseNoneRepression/induction level
Oxygen availabilityAerobic, microaerobic, anaerobicAerobicTransport capacity

What are the common challenges in recombinant sorA expression and purification, and how can they be addressed?

Membrane protein expression and purification presents several technical challenges:

  • Protein aggregation: The hydrophobic nature of sorA (with multiple transmembrane domains) often leads to aggregation during overexpression. Solutions include:

    • Reducing expression temperature to 16-20°C

    • Using specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Incorporating fusion partners that enhance solubility (MBP, SUMO)

  • Low expression yields: Membrane proteins typically express at lower levels than soluble proteins. Strategies to improve yields include:

    • Codon optimization for the expression host

    • Testing different promoter strengths

    • Incorporating a C-terminal tag rather than N-terminal to avoid interference with membrane insertion

  • Extraction efficiency: Detergent selection is critical for efficient extraction from membranes. A systematic screening approach using different detergents (DDM, LDAO, CHAPS) at various concentrations should be employed.

  • Protein stability: The recombinant sorA protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Working aliquots should be kept at 4°C for no more than one week, and repeated freeze-thaw cycles should be avoided .

How can researchers effectively analyze contradictory results in sorA functional studies across different experimental systems?

When confronted with contradictory results, a systematic troubleshooting approach should be employed:

  • Strain background effects: Different bacterial strains may contain genetic modifiers that affect sorA function. Complementation studies using defined genetic backgrounds can help resolve strain-specific effects, as demonstrated in E. coli studies where laboratory strains K12, B, and C were L-sorbose-negative while some wild strains could utilize this sugar .

  • Experimental condition variations: Standardize critical parameters across experiments:

    • Growth phase of cultures (mid-log phase is typically optimal)

    • Buffer composition and pH

    • Temperature during assays

    • Substrate concentration ranges

  • Protein modification effects: Post-translational modifications or the presence of different fusion tags may affect function. Compare results with different construct designs.

  • Interaction with host factors: The requirement for host factors such as phosphofructokinase (pfkA), phosphocarrier protein (ptsH), and phosphotransferase enzyme I (ptsI) in L-sorbose utilization indicates that the absence of these factors could lead to contradictory results .

  • Data normalization approaches: Ensure that transport data is appropriately normalized to protein expression levels or cell density.

How can sorA be utilized as a model system for studying the evolution of substrate specificity in membrane transporters?

The sorA protein offers valuable opportunities for evolutionary studies:

  • Comparative sequence analysis: Alignment of sorA sequences from diverse bacterial species can identify conserved residues essential for general transport function versus variable regions potentially involved in substrate specificity.

  • Phylogenetic reconstruction: Building phylogenetic trees of sorA homologs can reveal evolutionary relationships and potential substrate specificity clusters.

  • Ancestral sequence reconstruction: Computational methods can predict ancestral sorA sequences, which can then be synthesized and characterized to understand evolutionary trajectories.

  • Horizontal gene transfer analysis: The distribution pattern of sor genes across bacterial species (as observed in E. coli where only some wild strains possess functional genes) suggests potential horizontal gene transfer events that can be mapped.

  • Directed evolution approaches: Laboratory evolution experiments exposing bacteria to alternative substrates can be used to select for sorA variants with altered specificity, providing insights into natural evolutionary processes.

This research approach can help understand how substrate specificity evolves in membrane transporters and potentially guide protein engineering efforts to modify substrate recognition properties.

What are the most promising approaches for integrating structural biology techniques with functional studies of sorA?

Integrating structural and functional analyses requires multidisciplinary approaches:

  • Cryo-electron microscopy: This technique can provide medium to high-resolution structures of sorA in different conformational states during the transport cycle, particularly if the protein is incorporated into nanodiscs or other membrane mimetics.

  • X-ray crystallography: While challenging for membrane proteins, crystallization of sorA can be attempted using lipidic cubic phase techniques or after stabilization with antibody fragments.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map solvent accessibility changes during substrate binding without requiring a high-resolution structure.

  • Molecular dynamics simulations: Using the amino acid sequence provided , homology models can be constructed and subjected to molecular dynamics simulations to predict substrate binding sites and conformational changes.

  • EPR spectroscopy: Site-directed spin labeling at strategic positions can monitor conformational changes during the transport cycle.

  • Correlating structure with function: Functional assays should be performed with sorA variants designed based on structural insights, creating an iterative process of structure-guided functional analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.