Recombinant Sorbose permease IID component (sorM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sorM; PTS system sorbose-specific EIID component; EIID-Sor; Sorbose permease IID component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
sorM
Target Protein Sequence
MEQKKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYPLKADQVAALKRH LVFFNTTPAVCGPVIAVTAAMEEARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLR PITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQLGFRKGVNIVSDMGGNLLQKL TEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGATVTMTVQNILDQLCPGLLALGLT LLMVRLLNKKVNPVWLIFALFGLGIIGNALGFLS
Uniprot No.

Target Background

Function

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a primary carbohydrate transport system, catalyzes the phosphorylation and translocation of sugar substrates across the cell membrane. The enzyme II SorABFM PTS system is involved in sorbose transport.

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sorbose permease IID component (sorM) and what is its role in bacterial metabolism?

The Sorbose permease IID component (sorM) is a membrane protein that functions as part of the phosphoenolpyruvate (PEP)-dependent phosphotransferase system (PTS) in bacteria. It specifically serves as the IID component of the sorbose-specific PTS system. This protein plays a critical role in the transport and concurrent phosphorylation of sorbose across the bacterial cell membrane.

In the PTS system, the phosphoryl group from PEP is transferred through a cascade involving several proteins: first to Enzyme I (EI), then to HPr (histidine-containing phosphocarrier protein), followed by domain IIA and IIB, and finally to the sugar substrate during its translocation through the membrane-spanning IIC and IID domains . The sorM protein specifically forms part of this translocation channel, facilitating the passage of sorbose into the bacterial cell while the sugar becomes phosphorylated.

In Klebsiella pneumoniae, where sorM has been well-characterized, this protein contains 274 amino acids and is integral to the bacterial capacity to utilize sorbose as a carbon source .

What are the optimal conditions for expressing recombinant sorM in E. coli?

For successful expression of recombinant sorM in E. coli, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with strong, inducible promoters such as T7 or tac promoters. The pET system is particularly effective for membrane proteins like sorM.

  • E. coli strain selection: BL21(DE3) or its derivatives are recommended due to their reduced protease activity and compatibility with T7 expression systems.

  • Induction conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding of membrane proteins

    • IPTG concentration: 0.1-0.5 mM is typically optimal

    • Induction time: Extended periods (12-18 hours) at lower temperatures yield better results than short periods at 37°C

  • Media supplementation: The addition of glucose (0.5-1%) can help reduce basal expression before induction.

  • Membrane protein considerations: Addition of glycerol (5-10%) to growth media can help stabilize membrane proteins during expression .

The expression should be validated by SDS-PAGE analysis, with expected purity greater than 90% after purification steps .

What purification strategy yields the highest purity and activity for recombinant His-tagged sorM?

A systematic purification strategy for His-tagged sorM should include:

  • Cell lysis optimization:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) at concentrations just above their critical micelle concentration

    • Include protease inhibitors (PMSF, EDTA, leupeptin)

    • Perform lysis by sonication or French press under cold conditions (4°C)

  • Membrane fraction isolation:

    • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize membranes in detergent buffer for 1-2 hours at 4°C

  • Affinity chromatography:

    • Use Ni-NTA resin for His-tagged proteins

    • Include 20-40 mM imidazole in binding buffer to reduce non-specific binding

    • Wash with increasing imidazole concentrations (50-80 mM)

    • Elute with 250-300 mM imidazole

  • Post-purification handling:

    • Buffer exchange to remove imidazole through dialysis or gel filtration

    • Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

    • Add glycerol (5-50%) for long-term storage at -20°C/-80°C

This approach typically yields protein with >90% purity as assessed by SDS-PAGE, suitable for functional and structural studies.

How can researchers measure the transport activity of recombinant sorM in reconstituted systems?

To measure transport activity of recombinant sorM in reconstituted systems, researchers should implement the following methodological approach:

  • Proteoliposome preparation:

    • Purify sorM to >95% homogeneity

    • Mix purified protein with lipids (typically E. coli polar lipids and phosphatidylcholine at 3:1 ratio)

    • Remove detergent using Bio-Beads or dialysis to form proteoliposomes

    • Control protein-to-lipid ratio (1:100 to 1:200 by weight)

  • Transport assay setup:

    • Use radiolabeled substrates (14C-sorbose) or fluorescent analogs

    • Initiate transport by adding substrate to proteoliposomes

    • At defined time points, filter samples through 0.22 μm filters

    • Wash filters to remove unincorporated substrate

    • Measure incorporated substrate by scintillation counting or fluorescence

  • Alternative approach using SSM-based electrophysiology:

    • Solid-supported membrane (SSM) technology allows monitoring of electrogenic transport

    • This technique is particularly valuable for PTS components as it can detect half-reactions and pre-steady-state kinetics

    • Commercial systems like SURFE2R N1 can be employed for this purpose

  • Data analysis:

    • Calculate initial rates from linear portion of uptake curves

    • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten kinetics

    • Compare substrate specificity by competition experiments similar to those described for other PTS systems

What are the most effective methods to study substrate specificity of sorM?

To effectively characterize substrate specificity of sorM, researchers should employ these methodological approaches:

  • Competition assays:

    • Measure phosphorylation or transport of a known substrate (e.g., sorbose) in the presence of varying concentrations of potential competing sugars

    • Calculate IC50 values for each competitor

    • Analysis similar to the approach used for glucose/mannose PTS where 10-fold mannose excess reduced glucose phosphorylation by approximately 2-fold

  • Direct transport measurements:

    • Use radioactively labeled sugars to directly measure transport rates

    • Create a panel of structurally related sugars to test

    • Compare initial rates of transport for different substrates

  • PEP-dependent phosphorylation assays:

    • Reconstitute the complete PTS system with purified components (EI, HPr, IIAB, and membrane fractions containing IIC/IID)

    • Measure PEP-dependent phosphorylation of different sugars

    • A typical reaction mixture would contain:

ComponentConcentration
Purified His6-EI0.5-1 μM
Purified His6-HPr5-10 μM
Purified His6-IIAB5-10 μM
Membrane fraction0.1-0.5 mg/ml
PEP5 mM
Sugar substrate0.1-10 mM
Buffer50 mM Tris-HCl, pH 7.5
MgCl25 mM
DTT1 mM
  • FRET-based approaches:

    • Design fluorescence resonance emission transmission (FRET) substrates with fluorophore/quencher pairs

    • Monitor substrate binding by measuring changes in fluorescence

    • This approach has been successful for studying sortase substrate specificity and could be adapted for PTS components

How can researchers identify and characterize interactions between sorM and other PTS components?

To study protein-protein interactions between sorM and other PTS components, researchers should employ these methodological approaches:

  • Co-purification and pull-down assays:

    • Express sorM with an affinity tag (His-tag)

    • Use the tagged protein to pull down interacting partners from cell lysates

    • Analyze by SDS-PAGE and mass spectrometry

    • Confirm specific interactions by using purified components

    • Include appropriate controls with unrelated membrane proteins

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified sorM or potential interacting partners on sensor chips

    • Measure binding kinetics in real-time

    • Determine association (kon) and dissociation (koff) rate constants

    • Calculate equilibrium dissociation constants (KD)

  • Förster Resonance Energy Transfer (FRET):

    • Label sorM and potential partner proteins with appropriate fluorophore pairs

    • Measure energy transfer as an indication of proximity

    • This approach is particularly useful for detecting transient interactions in the phosphoryl transfer cascade

  • Bacterial Two-Hybrid (BTH) analysis:

    • Clone sorM and potential interacting proteins into appropriate BTH vectors

    • Co-transform into reporter strains

    • Measure reporter gene expression as an indicator of protein-protein interaction

    • This system allows screening of libraries for novel interacting partners

  • In vitro reconstitution of phosphoryl transfer:

    • Mix purified components (EI, HPr, IIAB, and sorM-containing membranes)

    • Monitor phosphoryl transfer through the cascade

    • Quantify using 32P-PEP or specific antibodies against phosphorylated residues

    • Similar to the approach used for Streptococcus thermophilus PTS components

What techniques can be used to study the membrane topology of sorM?

Understanding the membrane topology of sorM requires specialized approaches:

  • Cysteine scanning mutagenesis:

    • Create a cysteine-less version of sorM

    • Introduce single cysteines at various positions

    • Use membrane-impermeable sulfhydryl reagents to probe accessibility

    • Positions accessible only from one side of the membrane reveal topology

  • Fusion protein approaches:

    • Create fusions with reporter proteins like alkaline phosphatase (PhoA) or green fluorescent protein (GFP)

    • PhoA is only active when located in the periplasm

    • GFP fluorescence is quenched in the periplasm

    • By measuring activity/fluorescence of different fusion constructs, topology can be mapped

  • Protease accessibility:

    • Prepare membrane vesicles with defined orientation

    • Treat with proteases under controlled conditions

    • Analyze protected fragments by mass spectrometry or Western blotting

    • This reveals exposed vs. membrane-embedded regions

  • Computational prediction and validation:

    • Use algorithms like TMHMM, HMMTOP, or Phobius to predict transmembrane regions

    • Based on the amino acid sequence of sorM, these tools predict:

Predicted TM regionAmino acid positionsOrientation prediction
TM145-67in-out
TM289-111out-in
TM3123-145in-out
TM4178-200out-in
TM5225-247in-out
TM6252-274out-in

Note: This is a hypothetical prediction table as exact topology data for sorM was not provided in the search results.

  • EPR spectroscopy with spin labels:

    • Introduce spin labels at specific positions in sorM

    • Measure accessibility parameters and mobility

    • Create distance constraints to refine structural models

What are the challenges and solutions in crystallizing membrane proteins like sorM?

Crystallizing membrane proteins like sorM presents specific challenges that require methodical approaches:

  • Challenges in crystallization:

    • Hydrophobicity and instability outside native membrane environment

    • Conformational heterogeneity

    • Limited polar surface area for crystal contacts

    • Detergent micelles masking potential crystal contacts

  • Optimized purification strategies:

    • Screen multiple detergents (DDM, OG, LDAO, etc.) for optimal extraction and stability

    • Purify to >95% homogeneity with minimal aggregation

    • Assess protein homogeneity by size-exclusion chromatography

    • Consider lipid addition during purification to maintain native-like environment

  • Crystallization approaches:

    • Detergent-based methods:

      • Vapor diffusion (sitting or hanging drop)

      • Lipidic cubic phase (LCP) for increasing polar contacts

      • Bicelle crystallization combining lipids and detergents

    • Protein engineering strategies:

      • Thermostabilizing mutations identified through alanine scanning

      • Fusion with crystallization chaperones (T4 lysozyme, BRIL, etc.)

      • Antibody fragment co-crystallization to increase polar surface area

      • Truncation of flexible regions

  • Screening optimization:

    • Broader screening of crystallization conditions (500-1000 conditions)

    • Inclusion of additives specific for membrane proteins

    • Variation in protein:precipitant ratio (typically 1:1, 2:1, and 1:2)

    • Temperature variation (4°C, 18°C, and room temperature)

  • Alternative structural approaches:

    • Cryo-electron microscopy for larger complexes

    • NMR for smaller membrane proteins or fragments

    • Computational modeling based on homologous structures

How can researchers use computational methods to predict structure-function relationships in sorM?

Computational approaches provide valuable insights into sorM structure-function relationships:

  • Homology modeling workflow:

    • Identify suitable templates through PSI-BLAST or HHpred

    • Align sequences accounting for transmembrane regions

    • Generate models using software like MODELLER, SWISS-MODEL, or Rosetta

    • Embed models in simulated lipid bilayers

    • Refine through molecular dynamics simulations

    • Validate models against experimental data

  • Molecular dynamics simulations:

    • Prepare protein-membrane systems using tools like CHARMM-GUI

    • Simulate protein behavior in explicit membrane and solvent

    • Analyze conformational changes, water accessibility, and substrate pathways

    • Typical simulation parameters:

ParameterRecommended setting
Force fieldCHARMM36 or AMBER lipid14
Water modelTIP3P
System sizeProtein + 10Å water padding
Equilibration10-50 ns with restraints
Production100-1000 ns
Time step2 fs with SHAKE/LINCS
  • Substrate docking and binding site analysis:

    • Identify potential binding pockets using tools like CASTp or POCKET

    • Dock substrate molecules using Autodock, GOLD, or Glide

    • Analyze binding modes and key interacting residues

    • Compare with experimental mutagenesis data

  • Residue coevolution analysis:

    • Using methods like Direct Coupling Analysis (DCA) or GREMLIN

    • Identify co-evolving residue pairs from multiple sequence alignments

    • Predict structural contacts and functional relationships

    • Distinguish between structural and functional constraints

  • Integrating experimental data:

    • Use experimental constraints (crosslinking, FRET, EPR) to validate models

    • Incorporate mass spectrometry data on accessible regions

    • Use mutagenesis data to confirm predicted functional residues

    • Iterative refinement of models based on new experimental data

How should researchers design a systematic mutational study of sorM to identify critical residues for substrate specificity?

A comprehensive mutational analysis of sorM requires careful planning and systematic approaches:

  • Selection of target residues:

    • Focus on predicted substrate-binding regions based on homology with other PTS components

    • Target residues within predicted transmembrane segments, particularly those facing the transport channel

    • Include conserved residues identified through multiple sequence alignment

    • Consider residues predicted to be involved in inter-domain interactions

  • Mutation design strategy:

    • Perform alanine scanning of targeted regions

    • Create conservative substitutions to probe specific interactions:

      • Charge reversals (D→K, E→R) to test electrostatic interactions

      • Polarity changes (S→A, T→V) to test hydrogen bonding

      • Size alterations (G→A, A→V, V→L) to probe spatial constraints

    • Design chimeric proteins by swapping domains with related PTS components to alter specificity

  • Functional assay design:

    • Measure substrate transport or phosphorylation using methods described earlier

    • Determine kinetic parameters (Km, Vmax) for each mutant

    • Compare substrate specificity profiles

    • Assess protein stability and membrane integration

  • Data interpretation framework:

    • Classify mutations based on their effects:

  • Validation through second-site suppressors:

    • For critical mutations, screen for second-site suppressors that restore function

    • This approach can reveal functional interactions between residues

    • Similar to the approach that identified functional relationships between PTS components in other systems

What are the approaches to study the phosphorylation mechanism in the PTS system involving sorM?

To elucidate the phosphorylation mechanism involving sorM in the PTS system:

  • Identification of phosphorylation sites:

    • Use site-directed mutagenesis to replace conserved histidine residues potentially involved in phosphoryl transfer

    • Create H→A mutations to abolish phosphorylation

    • Create H→Q mutations to maintain size but prevent phosphorylation

    • Validate using mass spectrometry to directly detect phosphorylated residues

  • Phosphoryl transfer kinetics:

    • Use 32P-PEP as initial phosphoryl donor

    • Track phosphoryl transfer through the cascade (EI → HPr → IIAB → sugar)

    • Measure time-dependent appearance of 32P in each component

    • Determine rate-limiting steps in the phosphoryl transfer cascade

  • In vitro reconstitution system:

    • Purify individual components (EI, HPr, IIAB, IIC/sorM-containing membranes)

    • Combine in defined ratios

    • Measure PEP-dependent phosphorylation of sorbose

    • Similar to the approach used for S. thermophilus PTS components

  • Pre-steady-state kinetics:

    • Use rapid mixing techniques (stopped-flow) to observe early events

    • Monitor phosphoryl transfer using intrinsic protein fluorescence or FRET

    • Determine rate constants for individual steps

    • SSM-based electrophysiology can also monitor pre-steady-state events

  • Domain interaction studies:

    • Investigate interactions between IIAB and sorM (IID)

    • Determine how phosphorylation affects these interactions

    • Use techniques like SPR or FRET to measure binding affinities in different phosphorylation states

How can sorM be utilized in synthetic biology applications for sugar transport and sensing?

Recombinant sorM offers several opportunities for synthetic biology applications:

  • Engineering sugar transport systems:

    • Create hybrid transporters by fusing sorM with other PTS components to alter specificity

    • Express sorM in non-native hosts to enable sorbose utilization

    • Design metabolic pathways that utilize transported sorbose for valuable product synthesis

    • Typical engineering workflow:

StepApproachConsideration
1Clone sorM with required PTS componentsEnsure compatible expression levels
2Optimize expression in target organismCodon optimization may be necessary
3Verify functional transportUse growth assays with sorbose as sole carbon source
4Integrate with downstream metabolismMay require additional enzyme expression
5Optimize flux balanceAdjust expression levels to prevent bottlenecks
  • Biosensor development:

    • Create whole-cell biosensors for sorbose detection

    • Couple sugar transport through sorM to reporter gene expression

    • Design cell-free biosensors using purified components

    • Applications in environmental monitoring and quality control

  • Metabolic engineering applications:

    • Expand substrate range of industrial strains

    • Create strains capable of utilizing mixed sugar sources

    • Channel sorbose carbon into valuable products like biofuels or chemicals

    • Implement dynamic regulation of metabolism based on sugar availability

  • Protein scaffold engineering:

    • Use sorM as a membrane anchor for displaying proteins on cell surface

    • Create functional membrane protein fusions

    • Develop new biotechnological applications based on membrane localization

  • Evolution and adaptation studies:

    • Directed evolution of sorM for altered specificity

    • Study adaptation to new carbon sources

    • Investigate evolutionary constraints on transport proteins

What approaches can be used to study the role of sorM in bacterial physiology and metabolism?

To investigate the physiological and metabolic roles of sorM in bacteria:

  • Gene knockout and complementation studies:

    • Generate sorM deletion mutants using CRISPR-Cas9 or traditional methods

    • Complement with wild-type or mutant versions

    • Assess growth on different carbon sources

    • Measure changes in global metabolism through metabolomics

  • Transcriptional regulation analysis:

    • Identify potential catabolic responsive elements (CRE) in the promoter region

    • Similar to the putative CRE sequence found in the PTS operon of S. thermophilus

    • Use reporter fusions to measure expression under different conditions

    • Perform chromatin immunoprecipitation (ChIP) to identify regulatory proteins

    • Typical workflow for regulation studies:

MethodPurposeAnalysis approach
RT-qPCRMeasure expression levelsCompare transcript levels under different conditions
RNA-SeqGlobal transcriptional analysisIdentify co-regulated genes
Primer extensionMap transcription start sitesIdentify precise promoter elements
Gel shift assaysIdentify protein-DNA interactionsTest specific regulatory proteins
In vivo reporter assaysValidate regulatory elementsMeasure activity of promoter variants
  • Metabolic flux analysis:

    • Use 13C-labeled sorbose to track carbon flow

    • Measure incorporation into central metabolic intermediates

    • Quantify flux distribution using mass spectrometry

    • Compare wild-type and sorM mutant strains

  • Integration with systems biology approaches:

    • Perform multi-omics analysis (transcriptomics, proteomics, metabolomics)

    • Create genome-scale metabolic models incorporating sorM function

    • Predict and validate metabolic phenotypes

  • Ecological and evolutionary studies:

    • Compare sorM sequences and functionality across different bacteria

    • Investigate horizontal gene transfer of PTS components

    • Study niche adaptation related to sugar utilization

    • Analyze coevolution with substrate availability in different environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.